KEGG   Xenopus laevis (African clawed frog): 444781Help
Entry
444781            CDS       T01010                                 

Gene name
cdk14.L, cdk14, pftaire1, pftk1
Definition
(RefSeq) cyclin-dependent kinase 14 L homeolog
  KO
K08821  cyclin-dependent kinase 14 [EC:2.7.11.22]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    444781 (cdk14.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     444781 (cdk14.L)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CMGC group
  CDK family
   444781 (cdk14.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 444781
NCBI-ProteinID: NP_001086352
Xenbase: XB-GENE-943254
UniProt: Q6DJM7
Position
6L
AA seq 435 aa AA seqDB search
MCDMIESQPAQKIGKMKKLRRTLSDSFSRIALKKDENAIDEICVTKMSTRNCQGIDSVIK
HLDPIPEDKKVRVQRTQSSFDPFEKTSNQPTSPKFGKADSYEKLEKLGEGSYATVFKGKS
KVNGKLVALKVIRLQEEEGTPFTAIREASLLKGLKHANIVLLHDIIHTKETLTLVFEYVH
TDLCQYMDKHPGGLNPENVKLFLFQLLRGLSYIHQGHILHRDLKPQNLLISDTGELKLAD
FGLARAKSVPSHTYSNEVVTLWYRPPDVLLGSTDYSTCLDMWGVGCIFVEMIQGVAAFPG
MKDIQDQLERIFLILGTPIEETWPAVHSLPHFEPERFTLYGPKNLRQAWNKLSYVNHAED
LASKLLQCFPKNRLSAQAALNHDYFSDLPPRLWELSDMSSIFTVPNVKLQPEAGESMRVF
GKNNSFSKSLSNSKH
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatatgattgagtcgcagcctgctcagaaaatcggcaagatgaaaaagttgcgc
agaactttatctgacagttttagccgaatagctttgaaaaaagatgaaaatgcaattgac
gagatatgtgtcaccaagatgtcgacacggaactgccagggaatagactcggtcataaag
catctcgaccccattcctgaagacaagaaggtcagggtgcagaggacacagagcagtttt
gacccctttgaaaaaacatcaaaccagccaacaagtccaaaatttggaaaggccgattct
tatgaaaaactggaaaaattaggagaaggctcatatgctacagtttttaaaggaaaaagc
aaagtaaacggcaagttggtagcactgaaggtgataagactgcaagaagaagaagggact
ccgtttactgcaatcagggaagcttcacttctaaaaggactgaagcatgctaacattgtg
ttgttgcatgatattattcatacgaaggagacgttgaccctcgtctttgaatacgtgcat
acagatttatgtcagtatatggataaacacccaggaggtctgaatccagagaatgtgaag
ttatttttatttcagttgctgcgtggtttgtcctatatccaccaaggccatattttacac
agggatctgaagccacaaaaccttctaatcagcgatacaggggaactgaaactggccgac
tttggtcttgcaagagccaagtctgtaccaagccacacgtactccaatgaagtagtgaca
ctctggtacagacctccagatgtcctcctgggctccaccgactattccacctgccttgac
atgtggggtgttgggtgcatatttgtggaaatgatccagggagttgctgcatttccagga
atgaaagatattcaagaccaattggaacggatatttttgattctcgggacgcctattgaa
gagacgtggcctgcggtgcattctttgccacatttcgagccagaacgatttacgctatat
ggccctaagaatctaagacaagcttggaataagctgagctatgtgaatcatgcagaagat
ctagcctccaagctgctccagtgttttccaaagaacagactgtcggcgcaagctgctctg
aaccatgattatttcagtgatctccctccccggctatgggagctaagtgacatgtcttcc
atttttacggtaccgaatgtgaagttacagcctgaagctggagaaagtatgagagtgttt
gggaaaaacaatagtttcagcaaaagtctttcaaacagcaaacactga

DBGET integrated database retrieval system