KEGG   Xenopus laevis (African clawed frog): 446472Help
Entry
446472            CDS       T01010                                 

Gene name
etnppl.L, agxt2l1, etnppl
Definition
(RefSeq) ethanolamine-phosphate phospho-lyase L homeolog
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00564  Glycerophospholipid metabolism
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    446472 (etnppl.L)
Enzymes [BR:xla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     446472 (etnppl.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 446472
NCBI-ProteinID: NP_001086637
Xenbase: XB-GENE-6256217
UniProt: Q6DEB1 A0A1L8HUZ6
Position
1L
AA seq 509 aa AA seqDB search
MCEEYTKEKIMEIRKKHIGPSCKVFFANDPIKIVHAKGQYMFDEKGERYLDCINNVAHVG
HSHPEVTKAALKQMELLNTNSRFLHDNLVRYAECLISTLPEKLSVCYFVNSGSEANDLAL
RLARQYTGHQDVITLDHAYHGHVTSLIDISPYKFHQLGKDAQKEYIHVAPSPDTYRGKYR
EDHPDPASAYAKDVEDIIQKAHQNKRQIAAFIAESMQSCGGQIIPPAGYFQKVSEFVHKA
GGVFIADEVQVGFGRVGKHFWSFQLQGEDFLPDIVTMGKPIGNGHPMSCVVTTKEIAEAF
GATGMEYFNTFGGNPVSCAIGLAVLDIIEKEDLRGNATTVGNYLTELLNEQKQKHPLIGD
IRGVGLFVGVDLVKDRLFRTPATAEAQHIIYKLKEKRILLSADGPYRNVLKFKPPMCFNK
EDAKLVVDEIDQCLTALEKAIGIQSNAGLHEKTSAKRKVHNENSGDTNAKEKETCSSNSQ
ERNPNDHAYRQSNGLHPESPTFTRKRIRT
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaggagtacaccaaggaaaaaatcatggaaataagaaaaaagcacattgggccc
tcgtgcaaagtgttttttgcaaatgacccaatcaagattgtgcatgcaaaaggacaatac
atgtttgatgaaaaaggagagagatacttggactgcataaataatgttgctcatgttggc
catagtcaccccgaggtaacaaaggctgctttaaaacagatggaattgctaaacaccaat
tccaggtttctacatgacaaccttgtccgttatgctgagtgccttatatccacccttccg
gagaagctttcagtctgctattttgttaactctggctcagaagccaatgaccttgcactg
cgtctggcacgacagtatactggccatcaggatgtgatcactctagatcatgcttaccat
ggccatgtaacttccctgattgatattagtccctataaatttcatcagctgggaaaggat
gcacagaaggagtacatacatgtggctccttctcctgatacttacagaggaaaatacagg
gaagatcatcccgaccctgcatcagcttatgctaaagacgtagaggacatcattcagaaa
gctcatcagaacaaacgtcagattgctgcttttattgctgagtccatgcagagttgtgga
ggtcaaattatcccaccagcaggctacttccagaaagtgtcagagtttgtccataaagca
gggggagtcttcatagcagatgaagttcaagttggctttggaagagtcggcaaacatttt
tggagtttccaactacaaggagaagattttctaccagatattgtcaccatgggaaagcca
ataggcaatgggcacccaatgtcttgtgttgtaacaacaaaagaaattgcagaagccttt
ggagcaactggaatggaatattttaatacgtttggaggaaaccctgtatcctgtgcaatt
ggactggctgtgctggatattattgaaaaagaagatctcagagggaatgctaccacggtg
gggaattatttaactgagctattgaatgagcaaaaacaaaagcatcctttaataggagac
atcagaggagttggcttgtttgtcggagtggatttggttaaggacaggttgtttagaact
cctgcaacggctgaggcccagcatataatatataagctaaaagaaaaacgaatcttactg
agtgctgatggcccttacagaaatgtcctgaaattcaagcctccaatgtgctttaacaaa
gaggatgctaaactggttgtagatgaaattgatcaatgtcttacagctcttgaaaaagca
ataggaatccaatcaaatgcaggtttacatgaaaaaacttcagccaagagaaaggtgcat
aatgaaaattcaggggatactaacgcaaaagaaaaggaaacctgttccagcaactcacaa
gaaagaaacccaaatgaccatgcctacagacaaagcaatgggctgcaccctgagagcccc
acatttacacgcaaaagaataagaacatag

DBGET integrated database retrieval system