KEGG   Xenopus laevis (African clawed frog): 446773
Entry
446773            CDS       T01010                                 

Gene name
dck.2.L, dck, dck.2
Definition
(RefSeq) deoxycytidine kinase, gene 2 L homeolog
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00230  Purine metabolism
xla00240  Pyrimidine metabolism
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    446773 (dck.2.L)
   00240 Pyrimidine metabolism
    446773 (dck.2.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     446773 (dck.2.L)
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 AAA_17 Thymidylate_kin
Other DBs
NCBI-GeneID: 446773
NCBI-ProteinID: NP_001086938
Xenbase: XB-GENE-5727756
UniProt: Q6DD33
Position
3L
AA seq 264 aa
MATPPKRMCHSPVFNNSFEKRVKKLSIEGNIAAGKSTFVRILEKASDEWEVVPEPIAKWC
NVQTTENENEELSTSQKSGGNLLQMLYDKPTRWAYTFQTYACLSRVRAQLKTPSPKLLEA
EHPVQFFERSVYSDRYIFASSLFEFQNINETEWAIYQDWHTWFLNQFESDIDLDGIIYLR
ATPEKCMDRLHTRGREEEQGIQLEYLESLHYKHESWLYDRTMSVDFENLQHMPVMVLDVN
EDFKYDKIKQEALLDKVKEFLASL
NT seq 795 nt   +upstreamnt  +downstreamnt
atggcgactccccctaagagaatgtgtcacagtcctgtctttaacaacagctttgagaag
agagtcaagaagctttccatcgaaggcaatattgctgcgggaaaatccacctttgtgcga
atactggaaaaggccagcgacgaatgggaggtcgttccagaacccattgccaaatggtgt
aatgtccaaaccactgaaaatgaaaatgaggagctgtccacatctcagaagagtggagga
aatttgctacaaatgctgtacgataaacctacccggtgggcttatacatttcaaacttat
gcttgcttgagcagagtcagggcgcagctaaaaacaccatcccctaagttgctggaagcg
gaacatcctgtgcagttttttgaaagatctgtgtacagtgatcggtatatttttgcttcc
agcttatttgaatttcaaaacattaatgagacagagtgggccatttatcaagactggcat
acatggttcctaaatcagtttgaatccgacattgacttggatggaatcatctacctcaga
gctacaccagagaaatgtatggataggttacacactcgcggcagagaagaggagcaaggc
attcaacttgaatacttggaaagtttacattataagcatgaatcctggctttatgaccga
acaatgtcggtagattttgaaaacctacaacacatgccagttatggttttggatgtcaat
gaagactttaaatatgacaaaatcaaacaggaagcactgctcgacaaagtaaaggaattt
ttggcttccctctaa

DBGET integrated database retrieval system