KEGG   Xenopus laevis (African clawed frog): 447206Help
Entry
447206            CDS       T01010                                 

Gene name
esrra.L, esrra, nr3b1
Definition
(RefSeq) estrogen-related receptor alpha L homeolog
  KO
K08552  estrogen-related receptor alpha
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    447206 (esrra.L)
   03029 Mitochondrial biogenesis [BR:xla03029]
    447206 (esrra.L)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:xla03310]
    447206 (esrra.L)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen-like
    447206 (esrra.L)
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    447206 (esrra.L)
Nuclear receptors [BR:xla03310]
 3. Estrogen like
  3B. Estrogen-related receptor
   447206 (esrra.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 447206
NCBI-ProteinID: NP_001087382
Xenbase: XB-GENE-865526
UniProt: Q6AX97
Position
4L
AA seq 408 aa AA seqDB search
MSSRDRRPDLCIKAEPGTPESIGRRSPSGSSDSSGHGPDPPGPRCCRDEEQDDVSGRGKY
VLNSIPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGNIEYSCPASNECEITKRRRK
ACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPDGDILQYSSGGQAQQASATVVKKQ
TPVNAVVSHLLVAEPDKLFAMPDPALPDGDLKYMSTLCDLADREIVIIISWAKNIPGFSS
LSLSDQMSLLQSVWMEVLLLGVVFRSLPYEDEVVFAEDFVLDEESSRSGRLTDLCSCVLH
LVRKYRTLRVEKEEYVMLKALTLTNSDSVHIEDPDAVLRLRDALQEALSEYESGRHPEEP
CRDGKLLLTLPLLRQTAGRVLQHFHALREEGAVPMHKLFLEMLEAMMD
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcccgtgacagacgtccagatctttgcatcaaggctgaaccagggacacccgaa
agcattgggcgtcggagtcctagtggctctagtgatagtagcggccatggcccagaccct
ccaggaccacgctgttgcagagatgaggagcaagatgatgtatcaggccgtggcaaatat
gtcctaaactctattcccaaacgtctttgcctggtgtgtggagatgtggcatcaggctat
cactatggggttgcctcatgtgaggcatgcaaagccttcttcaagcgcaccatccaaggc
aatatcgagtacagctgtccagccagcaatgaatgtgaaattaccaagagacgtcgaaag
gcctgtcaagcttgccgcttcacaaagtgccttcgcgtgggcatgctaaaagaaggggta
cgcttggaccgtgtcagaggaggacgtcagaaatacaagaggaggccagatggagatatc
ctccagtactcgtctggtgggcaggctcagcaagcctctgcaacagtggtcaagaagcaa
actccagtgaatgcagttgtctctcacctgctggttgcagaaccagacaagttgtttgct
atgccagacccagcacttcctgatggtgatttgaaatatatgagcaccctgtgtgacctt
gctgatcgtgaaattgtcatcatcattagctgggcaaagaatatcccaggattctcctcc
ctttccctctcggaccagatgagtctcttgcagagtgtctggatggaggttttattgctt
ggagttgttttccgctcgcttccgtatgaagatgaggttgtgtttgctgaggattttgtg
cttgatgaggaatcttctcgctctggccgtctcactgatctctgctcatgcgtcctgcac
cttgtccgaaaatatcgcaccctgcgtgtggaaaaggaagagtacgtcatgctgaaggct
ctaaccctcactaactcagattctgtgcacattgaggatccagatgcagttctgcggctc
cgcgatgccctgcaagaagctctcagcgaatatgaatcaggtcgtcacccagaggagccc
tgcagggatggcaaactgctattaacactcccactactgcgtcagacagctggccgtgtc
ctccagcactttcatgccctgcgagaggagggagctgtccccatgcacaagctatttctg
gagatgttagaagctatgatggactga

DBGET integrated database retrieval system