KEGG   Xenopus laevis (African clawed frog): 447310Help
Entry
447310            CDS       T01010                                 

Gene name
wdr45b.S, wdr45b, wdr45l
Definition
(RefSeq) WD repeat domain 45B S homeolog
  KO
K22991  WD repeat-containing protein 45
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    447310 (wdr45b.S)
Membrane trafficking [BR:xla04131]
 Autophagy
  Other autophagy associated proteins
   Others
    447310 (wdr45b.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC4_WD40 DUF1513 PHTB1_N
Motif
Other DBs
NCBI-GeneID: 447310
NCBI-ProteinID: NP_001087486
Xenbase: XB-GENE-6254013
UniProt: Q68F45 A0A1L8EN29
Position
9_10S
AA seq 344 aa AA seqDB search
MNLLPSNPHGNGLLYSGFNQDHGCFACGMENGFRVYNTDPLKEKEKQEFLEGGVSYVEML
FRCNYLALVGGGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVVVLDSMI
KVFTFTHNPHQLHVFETCYNPKGLCVLCPNSNNSLLAFPGAHTGHVQIVDLASTEKPPVD
IPAHEGILSCIALNLQGTRIATASEKGTLIRIFDTSSGHLIQELRRGSQAANIYCINFNE
DASLICVSSDHGTVHIFAAEDPKRNKQSSLASASFLPKYFSSKWSFSKFQVPSGSPCICA
FGTEPNSVIAICADGSYYKFQFNPKGECTRDVYAQFLEMTDDKL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgctgccctcaaacccccacgggaacggactgctttactccgggttcaaccag
gaccatggatgctttgcatgcggcatggagaatggatttcgagtttataatacagatccc
ttgaaagaaaaagaaaagcaggaattcctagaaggaggcgtcagctatgtggaaatgttg
tttcgttgcaattacctggcattagtgggaggagggaagaagcccaaatacccacccaac
aaagtgatgatttgggatgatctgaagaagaaaacagtcattgaaatagaattttccacc
gaagtgaaggccgttaagctgcgccgagacaggattgtggtggtgctggattcaatgatt
aaagtgttcaccttcacacacaatccccatcagcttcatgtctttgagacctgctacaac
cctaaaggtctctgtgtcctgtgtccaaacagcaacaattccctcctggcatttcctggg
gctcacactgggcacgtgcagattgttgatcttgccagtacagagaagccacctgtagat
ataccagctcatgaggggatcctaagctgtatcgcactcaacttacaagggaccagaatc
gcgacagcatcggagaagggaactctcataagaatatttgatacctcatcgggacatttg
attcaggagctgcggagaggatcacaagctgcaaatatttattgtatcaacttcaatgaa
gacgcatccctgatctgtgtgtccagtgaccatgggaccgtacacatatttgcagccgag
gatccaaagagaaacaaacagtcaagtttggcctccgccagctttctccccaagtatttc
agctcaaagtggagcttttctaaatttcaggttccctccgggtcaccttgtatttgtgcc
tttggaacagaacccaattcagtcatagccatatgtgcagacggcagttactacaaattc
cagttcaatccgaagggtgagtgcacgcgggacgtctatgcccagtttttggaaatgacc
gatgacaaactttga

DBGET integrated database retrieval system