KEGG   Xenopus laevis (African clawed frog): 447549
Entry
447549            CDS       T01010                                 

Gene name
rdh5.S
Definition
(RefSeq) retinol dehydrogenase 5 (11-cis/9-cis) S homeolog
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    447549 (rdh5.S)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     447549 (rdh5.S)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776 NAD_binding_10
Other DBs
NCBI-GeneID: 447549
NCBI-ProteinID: NP_001087725
Xenbase: XB-GENE-17344488
UniProt: Q66IY4
Position
2S
AA seq 319 aa
MWCYVLLFAIAWTIGWLLRDRQKISRFSNKYVFISGCDTGFGNLLAKRLSRKGFQVLAGC
LTQAGADDLQKACPTGLTCTLLDVTNQDSINKAVEWVKSEVGDRGLYGLVNNAGIANPIG
PTEWMTIQDYRKVMEVNAFGTIAVSLSFLSLIKKAQGRIINMASILGRISANGGGYCVSK
YAVEAFSDSLRRDMQHFGVRVCIIEPGFFKTAVTNLDSIERSLQLLWDQMPPETRMTYGD
KYFQQYLKVQRLIMNFICDPDISKVPKCIEHALQARYPRTRYSPGWDAKLVWLPASYMPA
FITDTVLAFVLPKPKHSVH
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtggtgctacgtgcttctttttgccatagcatggaccattgggtggctgctaagggac
aggcagaagatttcaagattctccaacaaatatgtctttatctctggctgtgacactggc
tttggcaatttgcttgcaaagagactgagccgaaagggattccaagtcctggctgggtgc
cttactcaagcaggagcagatgacctacagaaagcttgtcctactggtctcacgtgcact
ttactggatgttaccaatcaggacagtataaacaaggcagttgagtgggtgaagtcagag
gtgggagacagaggtctctatgggttagttaacaatgctgggatcgctaatcctatcggg
cccactgaatggatgaccatacaggactataggaaagttatggaagtcaatgcatttgga
accattgctgtctctttgagctttctgtcactgataaagaaggcacaggggcgtattata
aacatggccagcatccttggaaggatttcagctaatggaggagggtactgcgtatccaag
tatgctgtcgaggccttctctgacagtttaagacgggacatgcagcactttggggtaaga
gtgtgcatcatagagcctggattctttaagacggctgtgactaacctggattctattgag
cgctccttgcagctactctgggatcagatgccgcctgagacaaggatgacctatggggac
aagtatttccaacaatacctgaaagtgcaaagactcatcatgaacttcatctgtgatccg
gatatctccaaagtgcccaagtgtatagaacatgccttgcaagcccgatacccacgcaca
agatacagtccaggctgggatgccaagctggtgtggctaccagcctcttatatgccagca
ttcattacagacactgtactggcttttgtacttcccaaacccaagcacagtgtccattag

DBGET integrated database retrieval system