KEGG   Xenopus laevis (African clawed frog): 447705Help
Entry
447705            CDS       T01010                                 

Gene name
anxa11.S, anx11, anxa11, cap50
Definition
(RefSeq) annexin A11 S homeolog
  KO
K17095  annexin A7/11
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   447705 (anxa11.S)
  Exosomal proteins of other body fluids (saliva and urine)
   447705 (anxa11.S)
  Exosomal proteins of colorectal cancer cells
   447705 (anxa11.S)
  Exosomal proteins of bladder cancer cells
   447705 (anxa11.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin
Motif
Other DBs
NCBI-GeneID: 447705
NCBI-ProteinID: NP_001087844
Xenbase: XB-GENE-958583
UniProt: Q641H0
Position
Un
AA seq 502 aa AA seqDB search
MSYPGYPGGFPPVPTGSNPWGAPVNPPPIGMDNMSNFPQQYNPQQYMTSGYPPSGFGGMG
QQQGMYPQAPGGGYPAPPGGYGAPPMPGQPQVPSYGMYPPPVAGQQPGMPGYNTGYPVAP
LPGQPMPTPSQPQMPMPGQPPVTYPGQQPTPSYPQGPAMNPSGPSYPSPGMPPSTTPTVT
PSYGKVKRGTITDAPNFDALRDAEVLRKAMKGFGTDEQAIIECLGNRSNKQRQQISLSFK
TAYGKDLIKDLKSELSGNFEKAILAMMKSPTLFDANEIREAIKGAGTDEECLIEILASRS
NAEIHEICALYKTEYKKTLEQAIKSDTSGHFERLLISLAQGNRDESNNVDMALVQRDVQE
LYAAGENRLGTDESKFNAILCARSRAHLNAVFSEYQRMCNRDIEKSICREMSGNLESGML
AVVKCLKNTPAFFAERLYKSMKGAGTKDKTLIRILVSRSEVDLLDIRVEYKRMYGKSLYT
DITGDTSGDYRKILLKLCGGND
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagctacccaggatacccgggtgggtttccaccagtgcccacaggtagtaacccatgg
ggagctcctgttaaccctcctcctattgggatggataacatgtcaaacttccctcagcaa
tacaacccccagcagtacatgacttcagggtacccgccatctggttttggaggaatgggc
caacaacagggaatgtaccctcaagctccaggtggaggctacccagcacctccaggtgga
tatggagcaccgccaatgcctgggcaacctcaagttccttcctatggcatgtatcctcct
ccagtagcaggccaacagccaggaatgcctgggtataatacaggatacccagtggcacct
ctgccaggccaacccatgccaacacccagccagccccagatgcccatgcctggacaaccc
ccagtgacatatcctggacagcagcctacaccaagttatcctcaaggcccagcaatgaat
ccatcagggccctcttacccatctcctggtatgccaccttcaacaacgcctactgtcaca
ccttcatatggaaaggtgaaacgaggaaccatcacagatgctccaaactttgatgcactg
agagatgctgaggtgcttaggaaggccatgaaaggctttggaactgatgagcaggccatt
attgagtgcctggggaatcgttctaacaaacaaaggcaacagatcagcctctctttcaaa
actgcctatggaaaggatttaataaaggatttaaaatccgagctctctggaaatttcgag
aaggcaatcctggcaatgatgaaatctccaactcttttcgatgcaaatgaaatacgtgag
gcaattaagggtgctggcacagatgaagaatgtctcattgagattctggcttctaggagc
aatgctgagatacatgaaatctgtgctttgtataaaacagaatataagaaaactttggaa
caagctattaaaagcgatacttctggtcacttcgaacggctgctaatttcactggctcag
ggaaatcgagatgaaagcaacaatgtagacatggcattagtccaacgagatgtacaggag
ctgtatgctgctggagagaatcgcctggggactgatgagtccaaatttaatgccatccta
tgtgcacgcagcagggcacaccttaatgcagtattttcagaataccagcgcatgtgcaat
cgggatattgagaaaagcatctgtcgtgagatgtctgggaaccttgaaagtggcatgctg
gcagtggtaaagtgcctaaaaaatacacctgccttcttcgccgagcgtctctacaaatca
atgaagggtgctggcacaaaggacaagactcttatccgtattctggtgtcccgtagtgag
gtagacttgcttgatatccgtgtggaatataaaaggatgtatggcaaatccctttacaca
gatatcacgggagacacatccggagactacaggaagattctgctaaaactctgtggggga
aacgactaa

DBGET integrated database retrieval system