KEGG   Xenopus laevis (African clawed frog): 495087Help
Entry
495087            CDS       T01010                                 

Gene name
acvr2a.S, XAR7, XSTK9, actrii, acvr2
Definition
(RefSeq) activin A receptor type IIA S homeolog
  KO
K04670  activin receptor type-2A [EC:2.7.11.30]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04060  Cytokine-cytokine receptor interaction
xla04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    495087 (acvr2a.S)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    495087 (acvr2a.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    495087 (acvr2a.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     495087 (acvr2a.S)
Protein kinases [BR:xla01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   495087 (acvr2a.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp Pkinase_fungal Dynein_IC2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 495087
NCBI-ProteinID: NP_001088256
Xenbase: XB-GENE-17332906
UniProt: Q9PSM0
Position
9_10S
AA seq 512 aa AA seqDB search
MGAATKLAFAVFLIFCSSGAILGRLETKECIYYNANWEKDKTNSNGTEPCYGDNDKRKHC
FATWKNTSGSIEIVKQGCWLDDVNCYNKNECIEKKESPDVFFCCCEGNACNERFYHSPEM
EVTQPTSNPVPKPPLFNTLLYSLVPIIVVAVIVLFLFWMYRHHKLGYPPELVPTQDPGPP
PPSPLLGLKPLQLLEVKARGRFGCVWKAQLLNETVAVKIFPIQDKLSWQNEYEIYSLPGM
KHENILHFIGAEKRGTNLDTDLWLITTFHEKGSLTDFLKANIVSWNELCHIAETMARGLS
YLHEDIPGLRDGHKPAVAHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQVG
TRRYMAPEVLEGAINFQRDAFLRIDMYAFGLVLWELASRCTAADGPVDEYMLPFEEEAGQ
HPSLEDMQEVVVHKKKRPILRECWQKHAGMAMLCETIEECWDHDAEARLSAGCVEERIIQ
MQKLTNIITTEDIVTVVTMVTNVDFPPKESSL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgggagctgctaccaagctggcctttgcagtctttcttatcttctgttcctcaggagcg
atcctcggaaggttggaaaccaaagaatgcatctactacaatgccaactgggagaaggac
aagacaaattccaatggcacagagccctgctatggagataatgataaaaggaaacactgc
tttgcaacgtggaagaacacctcgggctccatagaaatcgttaagcaaggctgctggttg
gacgacgtcaactgctacaacaagaatgagtgcatagagaaaaaggagagtcccgatgtg
tttttctgttgctgtgaaggaaacgcttgcaatgaaaggttctaccattcgccagagatg
gaggtcacacagcccacctcaaatcccgtacctaagccgcctttattcaacactctgctg
tactcactggtgcctatcatagtggttgcagtaattgttctcttcttgttttggatgtac
cgacatcacaagctcggctaccccccagagctggttccaacacaggacccaggcccccct
cctccgtctcctctgctgggattaaagccgttgcagctactggaggtgaaagccagaggg
aggttcggctgtgtgtggaaagcccagttattaaatgaaaccgtagcggtcaaaatattc
cctatacaggataaactgtcttggcaaaatgagtatgaaatctacagcctccctggaatg
aagcacgagaatatcctgcatttcattggcgcagaaaaacgtggcacaaacctcgacaca
gatctgtggttaattactactttccacgaaaagggctccctcacagactttctgaaagcc
aacatagtgtcttggaatgagctttgccatattgctgagacaatggccagaggcttatct
tacctccacgaagatatcccaggactgagagatggacacaaacctgcggtagcacatagg
gatatcaaaagcaaaaatgtgctacttaaaaacaatctgacagcctgcatagcagatttt
ggcctcgccttaaagttcgaagctgggaaatctgcaggggacactcatggccaggttgga
acccgcaggtacatggccccagaggtgttagaaggtgctataaatttccagagagatgcc
tttttaaggatagacatgtatgcatttggtttagtactttgggaactggcatcgaggtgc
actgctgcagatggtccagtcgatgagtatatgttaccttttgaagaagaagctgggcag
cacccatctctggaagacatgcaagaagtggtagtgcacaaaaagaaaagacccatttta
agggagtgctggcagaaacacgctggaatggcgatgctctgcgaaacgattgaggagtgc
tgggatcatgacgcagaagccaggttatcagccggctgcgtagaagagcgaatcattcaa
atgcaaaaactcacaaacattatcacaactgaggacattgtaacagtagtcacaatggtg
acaaacgttgactttccacccaaggaatcaagcctatga

DBGET integrated database retrieval system