KEGG   Xenopus laevis (African clawed frog): 495270Help
Entry
495270            CDS       T01010                                 

Gene name
ppib.S, cyp-s1, cypb, scylp
Definition
(RefSeq) peptidylprolyl isomerase B (cyclophilin B) S homeolog
  KO
K03768  peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:xla03110]
    495270 (ppib.S)
Enzymes [BR:xla01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     495270 (ppib.S)
Chaperones and folding catalysts [BR:xla03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    495270 (ppib.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase DUF3271
Motif
Other DBs
NCBI-GeneID: 495270
NCBI-ProteinID: NP_001088413
Xenbase: XB-GENE-17332304
UniProt: Q5XGR3
Position
3S
AA seq 216 aa AA seqDB search
MLRPLERNMKLLLAAALIAGSVIFLLFPGSSVADEKKKGPKVTEKVYFNIKIGDEDVGRI
VIGLFGKTVPKTVENFVTLATGEKGFGYQGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYG
EKFSDENFKLKHYGPYWLSMANAGKDTNGSQFFITTVKTPWLDGKHVVFGKILEGMDVVR
KIESTKTDGRDKPIKDVVIAECGKIEVEKPFAIAKE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggccattggagagaaacatgaagctattgttggctgctgcgctcatcgcgggc
tccgtcatattcctgctcttccctgggagctccgtagctgatgagaagaagaaagggccg
aaggtgaccgagaaggtgtactttaatataaagatcggagatgaggatgtaggacgtata
gtaatcggtctttttggaaaaactgttcccaagacggttgaaaattttgtaaccttggca
acaggggagaaaggatttggttaccaaggcagcaagttccaccgtgtcatcaaagacttt
atgatacaaggaggagattttactcgtggagatggtaccggaggaaaaagcatttatgga
gaaaagttttcagatgagaacttcaagctaaagcactatggcccatattggcttagtatg
gctaatgctggaaaagacactaatggttcccagttcttcataacaactgtcaagactcca
tggcttgatgggaaacatgttgtgtttggcaaaattctggaaggcatggatgttgtgcga
aagattgaatccactaaaacagatggtcgggataaaccaattaaagatgtggtcattgca
gaatgtggaaagatcgaggtagaaaagccatttgcaattgccaaagagtaa

DBGET integrated database retrieval system