KEGG   Xenopus laevis (African clawed frog): 495932Help
Entry
495932            CDS       T01010                                 

Gene name
cyb5r2.S, cyb5r2
Definition
(RefSeq) cytochrome b5 reductase 2 S homeolog
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    495932 (cyb5r2.S)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     495932 (cyb5r2.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 495932
NCBI-ProteinID: NP_001088670
Xenbase: XB-GENE-1006047
UniProt: Q5PQA4
Position
4S
AA seq 296 aa AA seqDB search
MLVALAAIGVTVLLFLIKALGSGAKKAPVTLLDPNAKYPLPLIEKQEISHDTKKFRFGLP
SAEHVLGLPVGQHIYLSAKVNGSLVVRAYTPVSSDEVKGHVDLVVKVYYKNVNPKFPDGG
KMSQHLDSLKIGETIDFRGPNGLLVYKGKGKFAIRPDKKAEPKIKVAKHVGMLAGGTGIT
PMLQLIRQITQDPNDNTKCYLIFANQTEDDILLRYELETVAKSHPEQFKLWYTLDRPPQG
WKYGSGFVTADMIKEHLPPPSEDVLVLMCGPPPMIQFACQDNLTKLGYPEAGRFAY
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgttggtagccctggcagcgataggagtaacagtgttattgttcctgattaaagctctg
ggatctggggctaagaaagcaccggtcactctgctggaccccaatgcaaagtacccacta
cctcttatagagaaacaggaaatcagccatgacactaagaaattcaggtttggcctcccc
tctgcagagcatgtcttggggctccctgtaggtcagcatatttacctctctgccaaggtc
aatgggagcctggtcgttcgggcgtatacgccggtgtccagcgatgaagtcaagggccac
gtggatctggttgtgaaggtgtattacaaaaacgtaaatcctaaattccccgacggaggc
aaaatgtctcagcatctggacagtctcaaaataggggaaacaattgatttccggggtccg
aatgggcttcttgtctacaaagggaaggggaaatttgccatcagaccagataagaaggct
gaaccaaagatcaaggtggccaaacacgtggggatgcttgctggtggaactgggattaca
cccatgttgcagctgattcgtcaaatcacccaggatcccaatgataacacaaaatgctac
ctcatctttgctaatcagacagaagacgacatcttgctacgatatgaactggaaactgta
gccaagagccacccggaacagtttaagctttggtacacgctggatcggcccccgcaaggg
tggaagtacggctctggttttgttactgcagacatgattaaagagcacctgcctcctccg
tccgaggatgtccttgtgctgatgtgcgggcctcctccaatgatccagtttgcgtgccaa
gacaacctgaccaagcttgggtaccccgaggctggaaggtttgcttactag

DBGET integrated database retrieval system