KEGG   Xenopus laevis (African clawed frog): 496083Help
Entry
496083            CDS       T01010                                 

Gene name
pigf.S, pigf
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class F S homeolog
  KO
K05287  GPI ethanolamine phosphate transferase 2/3 subunit F
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
xla01100  Metabolic pathways
Module
xla_M00065  GPI-anchor biosynthesis, core oligosaccharide
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    496083 (pigf.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIG-F DUF1634 Lig_chan Abhydrolase_9_N AgrB Peptidase_U4
Motif
Other DBs
NCBI-GeneID: 496083
NCBI-ProteinID: NP_001088813
Xenbase: XB-GENE-6252812
UniProt: Q5PPT8
Position
5S
AA seq 219 aa AA seqDB search
MDETELRRMSTGHVFCVIAVVLSIYIPTLFLDDFSFLGTHLSWLCICSLCVIIVHILFLL
TLKPNASSKKSSLANKFNKLTKSCIYFLISCFLFHGIIVLYGAPLVESVAETFLFAVLLS
SFTTSRCLCLLGPNFPAWVRVFSKDGALSVWDHSLQITTVCSVVGAWLGAFPIPLDWDRP
WQVWPISCSLGATIGYVVGLLIAPLWIYWNRKRLTYKSR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggatgagacagagctgagaagaatgtctactggacatgtcttctgtgtgattgctgta
gttctgtccatttatattccaactctgtttttggatgacttttccttcctgggaacacat
ctcagctggctgtgtatctgttccttgtgtgtcataatagtccatatcctctttcttcta
acactgaaaccaaatgcttcctccaaaaagagttcccttgcaaacaagttcaacaagctt
acaaagtcctgcatctactttctgatttcctgcttcctctttcatggaattatagtcttg
tatggagcgccacttgttgagagtgtggcagagacctttctgtttgctgttctcttatca
tctttcactacttcacgttgcctgtgtctactaggaccaaactttcctgcctgggtccga
gttttcagtaaagatggggcattgtctgtgtgggatcacagcctccaaataactactgta
tgcagtgtggtgggcgcttggcttggtgcattccctataccgttagattgggacaggcca
tggcaggtgtggcccatctcctgctcacttggtgctaccattgggtatgtggttggtctt
ctcatagctcctctgtggatctactggaacagaaagcggctcacctacaaaagcagatag

DBGET integrated database retrieval system