KEGG   Xenopus laevis (African clawed frog): 496349Help
Entry
496349            CDS       T01010                                 

Gene name
gna13.S, gna13
Definition
(RefSeq) guanine nucleotide binding protein (G protein), alpha 13 S homeolog
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04270  Vascular smooth muscle contraction
xla04371  Apelin signaling pathway
xla04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    496349 (gna13.S)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    496349 (gna13.S)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    496349 (gna13.S)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xla04147]
    496349 (gna13.S)
   04031 GTP-binding proteins [BR:xla04031]
    496349 (gna13.S)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   496349 (gna13.S)
  Exosomal proteins of colorectal cancer cells
   496349 (gna13.S)
GTP-binding proteins [BR:xla04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    496349 (gna13.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA MMR_HSR1 FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 496349
NCBI-ProteinID: NP_001088969
Xenbase: XB-GENE-6252082
UniProt: Q5HZN4
Position
9_10S
AA seq 377 aa AA seqDB search
MADFLPSHSMFSVCFPNCVLNSREADQQRKSKEIDRCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDLRAKEEFRSTIYSNVIKGIRVLVDAREKLHIPWGESANQKHGE
VMMAFDTRSAMVAQGMVETQVFMAHLVSIRALWADSGIQTAYDRRREFQLGESVKYFLDN
LGKLGDKDYLPTQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEYDQVLMEDRQTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
KIVSIKDYFADFEGEPHCLEDVQKFLVNCFRNKRRDQQQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggacttcctgccgtcccactcgatgttttccgtgtgctttcctaattgtgtgctc
aacagccgggaggccgaccagcagcgcaagtccaaggagatcgatcgctgcctatcccgg
gagaaaacttatgtcaaacgcctggtgaagatcctgttgctcggggccggggagagcggc
aaatctactttcctcaagcagatgcgcattatccacgggcaggacttcgatctgcgggcc
aaggaggagttccggtccaccatctacagcaatgtcatcaaaggtatccgggtactggtg
gatgcacgagagaagctccacattccatggggcgaatcagccaatcagaagcacggagag
gtgatgatggcttttgacacaaggtcagccatggtggcccagggtatggtggaaactcaa
gtattcatggcacacctggtatcgattagggcattgtgggcagacagtggcatacagacg
gcttacgatcggcgcagagaatttcaattgggggaatctgtgaagtatttcttggacaat
ctgggcaagctcggtgacaaggattatcttccaacccagcaagacatcctgctagcccga
cggcccaccaaaggaattcatgaatatgactttgagatcaaaaatgttcccttcaagatg
gtagatgtgggaggtcagaggtcagagcgcaagcgctggtttgagtgttttgacagcgtg
acctccatacttttcctggtgtcatcgagtgaatacgaccaagtcctgatggaagacagg
cagacaaaccgcctcactgagtctctgaacatctttgaaacaatagtcaacaaccgcgtg
ttcagcaacgtctccatcatcctattcctaaacaagactgacttgctggaggagaaagta
aaaatagtgagcattaaggactattttgcagatttcgaaggagagccccactgccttgaa
gatgtgcaaaagttcttggtaaattgtttccgaaacaagcggcgggatcagcagcagaaa
cctctctaccatcacttcaccaccgccataaacacggagaacattcgcctggttttccgc
gatgttaaagataccattcttcacgataacctcaagcagttaatgctgcagtaa

DBGET integrated database retrieval system