KEGG   Xenopus laevis (African clawed frog): 496391
Entry
496391            CDS       T01010                                 

Gene name
dck.1.L, dck, dck.1, dck1
Definition
(RefSeq) deoxycytidine kinase, gene 1 L homeolog
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00230  Purine metabolism
xla00240  Pyrimidine metabolism
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    496391 (dck.1.L)
   00240 Pyrimidine metabolism
    496391 (dck.1.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     496391 (dck.1.L)
SSDB
Motif
Pfam: dNK AAA_28 AAA_18 AAA_33
Other DBs
NCBI-GeneID: 496391
NCBI-ProteinID: NP_001089007
Xenbase: XB-GENE-956572
UniProt: Q5QKN1
Position
1S
AA seq 265 aa
MATPPKRICIELPPSPSGKKRKVKRISIEGNIATGKSTFVNILTKASEDWEVVPEPIARW
CNIQSCKDEFEELTNSQKSGGNLLQMMYEKPERWSFTFQSYACLSRIRAQLKALGGKLKE
SENPVLFFERSVYSDRYIFASNLYETECMNETEWTVYQDWHDWMNSQFGADLELDGIIYL
RAIPEKCLNRIHCRGRDEEQGIPMEYLEKLHYKHESWLHHRTMRTDFAYLQEIPILTLDV
NEDFKDNKPKQESLIEKVKEFLSTL
NT seq 798 nt   +upstreamnt  +downstreamnt
atggccactccaccgaagcggatttgcatcgaattgccgccatccccctcaggcaagaag
cgcaaggtcaagaggatctccatagagggaaacattgctacagggaaatctacctttgtc
aatattctcacaaaggccagtgaagactgggaggttgttcctgagcccatagcaagatgg
tgcaatattcagagctgcaaagatgaatttgaggagctaactaactctcagaaaagtgga
ggtaatctactccagatgatgtatgaaaagccagagcgctggtctttcactttccagtcc
tatgcttgtctgagccgcatcagggcccagctgaaggctctgggagggaaactgaaagaa
tcagaaaatccagtgctcttttttgaacgttcagtctatagtgacaggtatatctttgca
tccaatttatatgagacagagtgcatgaatgagactgaatggactgtttaccaggattgg
catgactggatgaattctcagttcggtgcagatcttgaactagatggaattatttatctc
cgcgccatccctgagaaatgtttaaacaggattcattgtcgtgggcgggatgaagagcag
ggaatccccatggagtatttggaaaaacttcattacaagcatgagagctggcttcatcac
agaactatgagaacggattttgcgtacctgcaggaaatccccatcctgactttagatgta
aatgaagatttcaaagataataaaccaaagcaagagagcctaattgaaaaggttaaagaa
tttttgagcactttatag

DBGET integrated database retrieval system