KEGG   Xenopus laevis (African clawed frog): 733318
Entry
733318            CDS       T01010                                 

Gene name
evi1
Definition
(RefSeq) ecotropic viral integration site 1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    733318 (evi1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    733318 (evi1)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    733318 (evi1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-H2C2_5 zf-C2H2_jaz zf-C2H2_8 zf-C2H2_11
Other DBs
NCBI-GeneID: 733318
NCBI-ProteinID: NP_001089102
UniProt: B7ZRU9
AA seq 1054 aa
MKSEDYSYARMAPDIHEERQYRCEECDQLFESKTELSDHQKYPCVTPHSAFSLVENSFPP
SLNDDSDLTEMQHTHECKECDQVFPDMQSLEKHLLSHTEEREYKCDQCPKAFNWKSNLIR
HQMSHDTGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACSDCGKTFATSSGLKQHK
HIHSSVKPFVCEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFC
EGKNHFATGGLFGQGISLPGTPAMDKASMISMNHANAGLADYFGASRHTAGLTFPTAPGF
PFSFPGLFPSSLYHRPPFIPPASPVKGLPGVEQSSKSQSPHVNQPQVLPATQDILKALSK
HPSVDENKALEFITENLNQRPHEKISDHSESSDLDDVSTPSGSDLETTSGSDLESDIESD
KDKLKENGKLYKDKMSPLQSLTALNSKREYNNHSVFSPCLEEQTAVTGAVNDSIKAIASI
AEKYFGSTGLVGLPDKKGTTLPYPSMFPLPFFPAFSQSMYTFPDRDVRPVPLKIEPESPK
ETKKVQKGKTESPFDLTTKRKEEKASPNVPSKSGAPTSSNHDQPLDLSMGSRSRAATTKQ
TEPRKNHIFNEKKDMDPELPKTSEHCLQHARPAPFFMDPIYRVEKRKPMDPLEILKEKYL
RPSPGFLFHPQFPMPDQRTWMSAIENMAEKLESFNALKPEANNFIQSVPLMFNFRASSSA
LPENLLRKGKERYTCRYWGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHV
RNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNLSGTAASSPHSEIEGTGPILDEKE
DSYFNEIRNFIGNSSHNKQSPLNSDERINGSHDKIMLAGQNSDILDDDEDEAILDEDDEE
SDIAVKVMKEPNTSVMLEKCSVDEYEEGGKSEVNSKVSPSRYDDEDDDDDEEEDFKKSLS
ALDHIRHFTDSLKMRKMDDGQFNDAELSAFTASHLTDDLKHPLYRKSKSQAYAMMLSLSD
QESLHPTTHTSSSMWHNLARAAAESTALHSVSHV
NT seq 3165 nt   +upstreamnt  +downstreamnt
atgaagagtgaagattattcctatgcaagaatggctccagatatccatgaggagcgccag
tatcgttgtgaagagtgtgatcaactgtttgagtccaaaacagagctgagcgatcaccag
aaatacccctgtgttacaccccactcagccttttcattagtggagaacagctttcctcca
agcctaaatgatgacagtgacctcacagagatgcagcatacccacgagtgcaaagaatgt
gaccaagtttttccagacatgcaaagcctggagaagcatttgctgtcccatacagaggag
agagagtacaaatgtgatcagtgtcctaaggcctttaactggaagtccaacctaattcgc
catcagatgtcacatgatacagggaagcactatgaatgtgaaaactgttccaagcaggtt
ttcacagatcctagcaacctccaaaggcacataaggtctcagcatgttggagcccgtgcg
catgcttgttctgactgcggcaaaacctttgctacatcatcaggtctcaagcaacacaag
cacatccacagcagtgtcaagccctttgtatgtgaagtctgccataagtcatatactcag
ttctccaatctctgtcgacacaagcgcatgcatgcagattgcaggactcagatcaaatgc
aaagactgtgggcaaatgttcagcaccacatcatcacttaataagcacaggaggttttgt
gaggggaaaaatcattttgctacaggaggactgtttgggcaaggcatttctcttcctgga
accccagccatggacaaagcttctatgattagtatgaaccacgcaaatgctggccttgca
gactattttggtgctagtcggcatactgctggtctcacattcccaacagctcctggattt
cctttcagttttcctggtctgtttccatcaagtctttaccaccgacccccttttatacct
cctgcttcaccggtgaaagggcttccaggtgttgaacagagcagcaagagccagagtccc
catgtgaaccagcctcaggtattaccagctacacaggacattttaaaagcactaagtaag
cacccatctgtagatgaaaataaggctctggagttcataacagagaatctgaaccagaga
ccacatgaaaagataagcgaccactcagagagtagtgaccttgatgatgtcagtactccg
agtgggagtgacttggagacaacctctggttctgaccttgaaagtgacattgaaagtgat
aaagacaaactgaaagaaaatggtaaactatataaagacaaaatgagccctttacagagc
ctaactgcactaaatagtaaaagggaatacaataatcattctgttttttcaccatgctta
gaggaacagactgctgtgacaggggcagtgaatgactctattaaagctattgcttccatt
gctgagaagtactttggttcaacaggactggtagggttgccagataaaaaaggcactaca
ttaccttacccatctatgttcccccttccatttttcccagcattctctcagtcaatgtat
acattccctgacagagatgtaagaccagtacctttaaaaatagaaccagaatctccaaaa
gaaactaagaaagtgcaaaaggggaaaacagaatcaccctttgatcttactaccaaacgt
aaagaggaaaaagctagccctaatgtgccctcaaaatctggtgctcctacatcttcaaac
cacgatcagcctttggacttaagcatgggcagcagaagccgggccgctaccacaaaacag
acagaacccagaaaaaatcatatctttaatgagaaaaaagacatggacccagaactacca
aaaacatctgagcactgcttacaacatgcaagacctgcaccgttctttatggatcctatt
tatagggtagaaaagagaaaaccaatggatcctctggaaattctaaaggaaaaatatttg
aggccatccccagggtttttatttcatccacagttccccatgccagaccagcgaacttgg
atgtcagcaatagaaaacatggcagaaaaactggagagtttcaatgccctcaaaccagaa
gccaacaactttatacagtctgttcctcttatgttcaatttccgagcttcatcaagtgcc
ctacctgagaatcttcttcggaagggaaaagagcgctatacctgcaggtactggggaaag
atttttcctagatctgcaaaccttactcggcatctacggactcacactggagagcagcct
tatcgatgcaaatactgtgatcgttcgttcagtatatcttcgaacttgcaaaggcacgtc
cgcaatatccacaacaaggagaaaccgtttaaatgccacctgtgtgacagatgttttggt
caacaaaccaacttggacagacatttaaaaaagcacgagaatggaaacttatctggtact
gcagcatcttctccccattcggaaatagaaggcacaggcccaatcttagatgaaaaagaa
gattcttactttaatgaaatacggaattttatagggaacagcagccacaataagcagtcc
cctttaaattcagatgaaagaataaatggcagccacgacaaaattatgctcgctggtcag
aattcagacatactggatgatgatgaagatgaagcaatccttgatgaagatgatgaagaa
agtgacattgctgttaaagtgatgaaggaacccaatacaagtgtcatgctggaaaaatgc
tctgtggatgaatacgaagaaggaggtaaatctgaagtcaacagcaaagtttcgcccagc
aggtatgatgatgaagatgacgacgatgatgaagaagaagatttcaagaaaagtctctct
gcattggaccacatcaggcacttcacagacagtctgaagatgcggaaaatggatgatggg
cagtttaatgatgctgagctatcggctttcactgcttcccacctgacagatgacctaaag
catccattgtacagaaaatcaaaatcacaggcatatgcaatgatgctgtctctgtctgat
caggaatccctccacccaactactcatacttcctccagcatgtggcacaacttagccaga
gcagctgccgaatccactgcactccactccgtgagccacgtatga

DBGET integrated database retrieval system