KEGG   Xenopus laevis (African clawed frog): 733381Help
Entry
733381            CDS       T01010                                 

Gene name
asb13.L, asb13
Definition
(RefSeq) ankyrin repeat and SOCS box containing 13 L homeolog
  KO
K10335  ankyrin repeat and SOCS box protein 13
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:xla04121]
    733381 (asb13.L)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     733381 (asb13.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5 SOCS_box Fanconi_C
Motif
Other DBs
NCBI-GeneID: 733381
NCBI-ProteinID: NP_001116359
Xenbase: XB-GENE-5837705
UniProt: Q08B81
Position
3L
AA seq 286 aa AA seqDB search
METEAVPIIASVALRGPLIGDIGNWHSRTPVHDASRHGNTSQLRELIDSGVCVNLVTVDS
ITPLHEACLHGHIQCVKLLLAAGAQVDARNIDGSTPLCDASAAGSLECVKFLLDNGAKVN
PPLFTASPLHEACMSGKSECVKLLIEVGANLEAHDCHFGTPLHVACAREHLDCAKALLHA
GANVNAAKLHETALHHAAKVKNTELVKMLVEFGGNVYARDNRGKKPTDYTWPNSPTAKCF
EYYEKTPRSLYQLCRLNLRKTLGQRAVEKILKLNIPTRLKQYLTYN
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagaggcagtgccaatcatcgcctcggtggctcttcggggccctctcatcggg
gacattggaaattggcattctagaacaccagtacatgatgcttctagacacggcaatact
tcgcagctcagagagctgattgacagcggggtctgtgtgaacctggttactgtggattca
ataacacctcttcatgaagcttgcctacatggacatatccagtgtgtgaagttgctgcta
gctgctggtgctcaggtggatgctagaaatattgatggaagcactcctctgtgtgatgcc
tctgcagcaggtagtctggaatgtgtgaagtttctcttagacaatggtgccaaagtgaac
cctccactttttactgcttcacccctccatgaagcttgcatgagtggaaaatcagaatgt
gtaaagttattgatagaagtaggagcaaaccttgaagctcatgattgccactttggaaca
cccttacatgtagcgtgcgccagagagcatttggactgtgcaaaggccttacttcatgca
ggagcaaatgtgaatgcagcaaaactccatgaaactgcacttcaccatgcagcaaaggtg
aaaaatacagagcttgtcaagatgttagttgaatttggaggaaatgtttatgccagagac
aataggggaaagaaacccacggattatacctggccaaacagtcctactgccaaatgtttt
gaatactatgaaaagacacccaggagcctttatcagctctgcaggcttaacctcagaaaa
acacttgggcaaagagctgtggaaaagattctcaaattaaatatccccacaagacttaag
caatatttaacatataattga

DBGET integrated database retrieval system