KEGG   Xenopus laevis (African clawed frog): 734157
Entry
734157            CDS       T01010                                 

Gene name
mecom.L, evi-1, evi1, mecom, mecom-a, mecom-b, xEvi-1
Definition
(RefSeq) MDS1 and EVI1 complex locus L homeolog
  KO
K04462  ecotropic virus integration site 1 protein
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    734157 (mecom.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    734157 (mecom.L)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    734157 (mecom.L)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-H2C2_5 zf-C2H2_jaz zf-BED zf-C2H2_8 zf-C2H2_11 PyrI_C zf-met
Other DBs
NCBI-GeneID: 734157
NCBI-ProteinID: NP_001089139
Xenbase: XB-GENE-980198
UniProt: B7ZRU9
Position
5L
AA seq 1055 aa
MKSEDYSYARMAPDIHEERQYRCEECDQLFESKTELSDHQKYPCVTPHSAFSLVENSFPP
SLNDDSDLTEMQHTHECKECDQVFPDMQSLEKHLLSHTEEREYKCDQCPKAFNWKSNLIR
HQMSHDTGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACSDCGKTFATSSGLKQHK
HIHSSVKPFVCEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFC
EGKNHFAAGGLFGQGISLPGTPAMDKASMISMNHANAGLADYFGASRHTAGLTFPTAPGF
PFSFPGLFPSSLYHRPPFIPPASPVKGLPGVEQSSKSQSPHVNQPQVLPATQDILKALSK
HPSVDENKALEFITESNLNQRPHEKISDHSESSDLDDVSTPSGSDLETTSGSDLESDIES
DKDKLKENGKLYKDKMSPLQSLAALNSKREYNNHSVFSPCLEEQTAVTGAVNDSIKAIAS
IAEKYFGSTGLVGLPDKKGTTLPYPSMFPLPFFPAFSQSMYTFPDRDVRPVPLKIEPESP
KETKKVQKGKTESPFDLTTKRKEEKASPNVPSKSGAPTSSNHDQPLDLSMGSRSRAATTK
QTEPRKNHIFNEKKDMDPELPKTSEHCLQHARPAPFFMDPIYRVEKRKPMDPLEILKEKY
LRPSPGFLFHPQFPMPDQRTLMSAIENMAEKLESFNALKPEANNLIQSVPSMFNFRASSS
ALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRH
VRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNLSGTAASSPHSEIEGTGPILDEK
EDSYFNEIRNFIGNSSHNKQSPLNSDERINGSHDKIMLAGQNSDILDDDEDEAILDEDDE
ESDIAVKVMKEPNTSVMLEKCSVDEYEEGGKSEVNSKVSPSRYDDEDDDDDEEEDFKKSL
SALDHIRHFTDSLKMRKMDDGQFNDAELSAFTASHLTDDLKHPLYRKSKSQAYAMMLSLS
DQESLHPTTHTSSSMWHNLARAAAESTALHSVSHV
NT seq 3168 nt   +upstreamnt  +downstreamnt
atgaagagtgaagattattcctatgcaagaatggctccagatatccatgaggagcgccag
tatcgttgtgaagagtgtgatcaactgtttgagtccaaaacagagctgagcgatcaccag
aaatacccctgtgttacaccccactcagccttttcattagtggagaacagctttcctcca
agcctaaatgatgacagtgacctcacagagatgcagcatacccacgagtgcaaagaatgt
gaccaagtttttccagacatgcaaagcctggagaagcatttgctgtcccatacagaggag
agagagtacaaatgtgatcagtgtcctaaggcctttaactggaagtccaacctaattcgc
catcagatgtcacatgatacagggaagcactatgaatgtgaaaactgttccaagcaggtt
ttcacagatcctagcaacctccaaaggcacataaggtctcagcatgttggagcccgtgcg
catgcttgttctgactgcggcaaaacctttgctacatcatcaggtctcaagcaacacaag
cacatccacagcagtgtcaagccctttgtatgtgaagtctgccataagtcatatactcag
ttctccaatctctgtcgacacaagcgcatgcatgcagattgcaggactcagatcaaatgc
aaagactgtgggcaaatgttcagcaccacatcatcacttaataagcacaggaggttttgt
gaggggaaaaatcattttgctgcaggaggactgtttgggcaaggcatttctcttcctgga
accccagccatggacaaagcttctatgattagtatgaaccacgcaaatgctggccttgcg
gactattttggtgctagtcggcatactgctggtctcacattcccaacagctcctggattt
cctttcagttttcctggtctgtttccatcaagtctttaccaccgacccccttttatacct
cctgcttcaccggtgaaagggcttccaggtgttgaacagagcagcaagagccagagtccc
catgtgaaccagcctcaggtattaccagctacacaggacattttaaaagcactaagtaag
cacccatctgtagatgaaaataaggctctggagttcataacagagagtaatctgaaccag
agaccacatgaaaagataagcgaccactcagagagtagtgaccttgatgatgtcagtact
ccgagtgggagtgacttggagacaacctctggttctgaccttgaaagtgacattgaaagt
gataaagacaaactgaaagaaaatggtaaactatataaagacaaaatgagccctttacag
agcctagctgcactaaatagtaaaagggaatacaataatcattctgttttttcaccatgc
ttagaggaacagactgctgtgacaggggcagtgaatgactctattaaagctattgcttcc
attgctgagaagtactttggttcaacaggactggtagggttgccagataaaaaaggcact
acattaccttacccatctatgttcccccttccatttttcccagcattctctcagtcaatg
tatacattccctgacagagatgtaagaccagtacctttaaaaatagaaccagaatctcca
aaagaaactaagaaagtgcaaaaggggaaaacagaatcaccctttgatcttactaccaaa
cgtaaagaggaaaaagctagcccaaatgtgccctcaaaatctggtgctcctacatcttca
aaccacgatcagcctttggacttaagcatgggcagcagaagccgggccgctaccacaaaa
cagacagaacccagaaaaaatcatatctttaatgagaaaaaagacatggacccagaacta
ccaaaaacatctgagcactgcttacaacatgcaagacctgcaccgttctttatggatcct
atttatagggtagaaaagagaaaaccaatggatcctctggaaattctaaaggaaaaatat
ttgaggccatccccagggtttttatttcatccacagttccccatgccagaccagcgaact
ttgatgtcagcaatagaaaacatggcagaaaaactggagagtttcaatgccctcaaacca
gaagccaacaaccttatacagtctgttccttctatgttcaatttccgagcttcatcaagt
gccctacctgagaatcttcttcggaagggaaaagagcgctatacctgcaggtactgtgga
aagatttttcctagatctgcaaaccttactcggcatctacggactcacactggagagcag
ccttatcgatgcaaatactgtgatcgttcgttcagtatatcttcgaacttgcaaaggcac
gtccgcaatatccacaacaaggagaaaccgtttaaatgccacctgtgtgacagatgtttt
ggtcaacaaaccaacttggacagacatttaaaaaagcacgagaatggaaacttatctggt
actgcagcatcttctccccattcggaaatagaaggcacaggcccaatcttagatgaaaaa
gaagattcttactttaatgaaatacggaattttatagggaacagcagccacaataagcag
tcccctttaaattcagatgaaagaataaatggcagccacgacaaaattatgctcgctggt
cagaattcagacatactggatgatgatgaagatgaagcaatccttgatgaagatgatgaa
gaaagtgacattgctgttaaagtgatgaaggaacccaatacaagtgtcatgctggaaaaa
tgctctgtggatgaatacgaagaaggaggtaaatctgaagtcaacagcaaagtttcgccc
agcaggtatgatgatgaagatgacgacgatgatgaagaagaagatttcaagaaaagtctc
tctgcattggaccacatcaggcacttcacagacagtctgaagatgcggaaaatggatgat
gggcagtttaatgatgctgagctatcggctttcactgcttcccacctgacagatgaccta
aagcatccattgtacagaaaatcaaaatcacaggcatatgcaatgatgctgtctctgtct
gatcaggaatccctccacccaactactcatacttcctccagcatgtggcacaacttagcc
agagcagctgccgaatccactgcactccactccgtgagccacgtatga

DBGET integrated database retrieval system