KEGG   Xenopus laevis (African clawed frog): 734303Help
Entry
734303            CDS       T01010                                 

Gene name
gtf2e2.L, gtf2e2
Definition
(RefSeq) general transcription factor IIE subunit 2 L homeolog
  KO
K03137  transcription initiation factor TFIIE subunit beta
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    734303 (gtf2e2.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:xla03021]
    734303 (gtf2e2.L)
Transcription machinery [BR:xla03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIE
     734303 (gtf2e2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIE_beta TFA2_Winged_2 DUF3841 EF-hand_11
Motif
Other DBs
NCBI-GeneID: 734303
NCBI-ProteinID: NP_001089256
Xenbase: XB-GENE-962390
UniProt: P29540 A0A1L8HVE9
Position
1L
AA seq 288 aa AA seqDB search
MDPALLRDRELFKKRALTTPAVEKRPSASSESSKKKRAKLELSSTSGSKPSSDGSNGSFN
LKSLSGSSGYKFGVLAKIVNYMKTRHQRGDTYPLTLEEILDETQHLDIGIKQKQWLMSEA
LVNNPKIEIIDGKYAFKPKYNLKDKKALLRLLDKHDQRGLGGILLEDIEEGLPNAQKAIK
ALGDQIVFVTRPDKKKILFYNDKSCQFTVDEEFQKLWRSVPVDSMDDEKIEEYLKRQGIS
SMQESGPKKIIPVQKRKKATSQRRRFKTHNDHLAGVLKDYTDVASGKP
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggatccagccctactaagagacagggagctctttaaaaagcgagctctgaccactcca
gctgtggaaaaacgtccaagtgcttcttctgaatcttcaaagaaaaagagagctaaactt
gaacttagtagcacttctggatccaagccaagctcagatggcagcaatgggtcatttaat
ctcaagagcctttctgggagttctggatacaagtttggtgtcctcgctaagatcgttaac
tatatgaagactcggcaccagcgaggagacacatatccactcacattagaggaaatcctg
gatgaaacacaacatcttgacatcggtatcaaacagaagcaatggctaatgtcagaggct
ttggtgaataatccaaaaattgagattattgatggtaaatatgcctttaagccaaagtac
aatttaaaagacaagaaagctctcctgaggctactagacaaacatgatcaacgaggcctt
ggtgggattctgcttgaagatatagaggaaggacttcccaatgcacagaaagccataaag
gcacttggcgatcagattgtatttgtaacacgaccggacaaaaagaaaatccttttctac
aatgacaaaagctgccagtttacagtagatgaagaattccagaagttatggaggagtgtc
ccagtagattccatggatgatgagaagattgaagaataccttaagaggcagggaatttct
tcaatgcaagaatctggaccaaagaaaattattccagtgcagaagagaaagaaggccacc
tcacagagaaggaggtttaagactcataacgaccacttggcaggagtgctgaaagattat
acagatgttgcttcaggcaaaccataa

DBGET integrated database retrieval system