KEGG   Xiphophorus maculatus (southern platyfish): 102216750
Entry
102216750         CDS       T02923                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase isoform X2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00100  Steroid biosynthesis
xma01100  Metabolic pathways
Module
xma_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    102216750 (tm7sf2)
Enzymes [BR:xma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     102216750 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 102216750
NCBI-ProteinID: XP_005800822
Ensembl: ENSXMAG00000005151
UniProt: A0A3B5QI22
Position
11
AA seq 424 aa
MGPKKALKHRLSNDTEREFGGTLGAVCIPVFLPLTVLFLICVSQSPEASVLQWPPCLPSA
DQLWDPLAPILLLGWIGLHVLLYLLPLGKVSDGLALRDGSRLKYPINGFHGLCISAVLLS
VLLGLGAPLGYLFELLVPLAVSAIAVSFLSSVYLYVRSFWAPSHALALGGDTGNPLYDFF
IGRELNPRIGNFDLKYFCELRPGLIGWGVINLGMLMKEAELRGSPSLSMILVNCFQLLYV
ADALWNEEAVLTTMDIVHDGFGFMLVFGDLAWVPFTYGLQASFLVVHPQSLSLLTAAAIV
ALNGAGYYIFRKSNSQKNQFRRDPTHPSVSGLETIATATGKRLLVSGWWGFVRHPNYLGD
LLMALAWSLPCGFSHLLPYFYVVYFTVLLVHREARDERQCRAKYGLAWDAYCRRVPYRIF
PYIY
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgggacccaagaaagccctgaaacacagactgtcaaacgacacagaaagagagtttgga
ggaactctgggtgccgtgtgcattcccgttttcctcccactgaccgttctcttcctgatc
tgtgtgagccaatcaccggaggccagcgtcctccagtggcccccctgcctcccctccgcc
gaccagctgtgggacccgctggctcccattctgctgctgggatggatcggactgcatgtc
ctcctctacttgctgccgttaggaaaggtttctgatggattagcgctgagggacggaagc
cgcctcaagtatcccataaatggtttccacggcctgtgcatcagcgccgtgttgctgtcg
gtgttgctggggctcggcgctcctcttggatatctgtttgagctgctggtgccgctggcg
gtgtctgccatcgccgtgtcgttcctgtcctccgtctacctctacgtccgctctttctgg
gctccctcccatgctctggccctggggggagacacagggaatcccctttatgacttcttc
attgggcgggagctgaaccctcggatcggaaactttgacctcaagtatttctgtgaactc
agaccaggtctgattggttggggggtcattaacctcgggatgctgatgaaggaggcggag
cttcgcggttctccttccctctccatgatcctcgtcaactgcttccagctgctttatgtg
gcagacgctttatggaacgaagaggccgttctgacaacaatggacattgtgcatgatggc
ttcgggttcatgctggtgtttggcgacctggcctgggttcccttcacctacggcctgcag
gcttccttcctggttgttcacccacagagtctgtctttgctcacggcggcggccatagtt
gccctcaacggtgctgggtattacattttcagaaaatccaactcgcagaagaaccagttc
aggcgagacccgactcaccccagtgtttcaggactggagaccatcgccacagcaacaggg
aaacggctgctggtgtcaggctggtggggcttcgttcgtcatcccaattacctcggcgac
ctccttatggcgctggcgtggtccctgccatgtggcttctctcatctcttgccatatttc
tacgtggtttacttcaccgtcctgctggttcaccgggaggcccgggacgagaggcagtgc
agggccaagtacggactcgcgtgggacgcctactgtcgccgagttccctacaggatcttc
ccgtacatttactga

DBGET integrated database retrieval system