KEGG   Xiphophorus maculatus (southern platyfish): 102218447Help
Entry
102218447         CDS       T02923                                 

Gene name
sephs1
Definition
(RefSeq) selenide, water dikinase 1
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00450  Selenocompound metabolism
xma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    102218447 (sephs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xma03016]
    102218447 (sephs1)
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     102218447 (sephs1)
Transfer RNA biogenesis [BR:xma03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    102218447 (sephs1)
 Prokaryotic Type
    102218447 (sephs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-GeneID: 102218447
NCBI-ProteinID: XP_005802080
Ensembl: ENSXMAG00000004677
UniProt: M3ZR49
Position
2
AA seq 392 aa AA seqDB search
MSVRESFNPESYELDKNFRLTRFAELKGTGCKVPQEVLQKLLEALQENHYQEDEQFLGAV
MPRLGIGMDTCVIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECD
NMLMLLGVSNKMSEKERDKVMPLIIQGFKDASEEAGTSVTGGQTVVNPWVVMGGVATTVC
QPNEFIMPDNAVPGDVLVLTKPLGTQVGVAVHQWLDIPEKWNKIKLVVTQEDVELAYHEA
MLNMARLNRTAASLMHTFNAHAATDITGFGILGHAQTLARQQRSEVSFVIHNLPVLAKMA
AVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKG
NRTARIIDKPRIIEVAPQAATQNVNPTPGATS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgagggagtcttttaaccccgaaagctatgagctggacaagaacttcaggctc
acgcgcttcgctgagctgaaggggacaggctgcaaggtccctcaagaggttttacagaag
ttgcttgaggccttacaggagaaccactatcaagaggatgaacagttcttgggggcagtc
atgccccgattaggaataggcatggacacatgtgtgatccctctcagacatggtggactt
tcccttgttcagacaacagattacatctatcctattgttgacgacccctacatgatggga
agaattgcttgtgccaatgttctaagtgacctgtatgccatgggagtgacagagtgtgac
aacatgttgatgcttctgggagtcagcaacaagatgtcagaaaaagaaagagacaaagtc
atgccactgatcattcagggattcaaggatgcttccgaggaggccggcacgtctgtcaca
gggggacaaacggtggttaacccctgggtggtaatgggaggagttgctacaacagtgtgt
cagcccaatgagttcatcatgcctgataacgcagtgcctggggatgtgttggtgttgacc
aaaccgttagggacccaagtaggtgttgcagtgcaccagtggctagacattcctgagaag
tggaacaaaatcaagctggtggtaacccaggaagacgtagagttggcctaccacgaagct
atgttgaacatggcccggctcaaccgtacagctgctagcctcatgcacaccttcaacgca
cacgcagccaccgacatcacagggttcggcatcctcggccacgcacagacgctagcacga
cagcagcggagcgaggtttccttcgtcatccacaatctcccagtgctcgccaagatggcc
gccgtgtccaaagcctgcgggaacatgtttggactcatgcatggcacctgccctgaaaca
tcaggaggcctgctcatctgtttgccccgggagcaggctgcccgcttctgcgccgagatc
aaatctccaaaatacggagagggtcaccaagcttggatcatcgggattgtagagaaagga
aaccgtaccgcccgcatcatcgacaagccacgaatcatcgaggtggcaccgcaagcagcc
acgcaaaatgtcaacccaacacccggcgcaacctcttaa

DBGET integrated database retrieval system