KEGG   Xiphophorus maculatus (southern platyfish): 102218697Help
Entry
102218697         CDS       T02923                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00071  Fatty acid degradation
xma01212  Fatty acid metabolism
xma03320  PPAR signaling pathway
xma04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102218697
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102218697
   03320 PPAR signaling pathway
    102218697
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:xma03029]
    102218697
Enzymes [BR:xma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     102218697
Mitochondrial biogenesis [BR:xma03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    102218697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N Sigma70_r2
Motif
Other DBs
NCBI-GeneID: 102218697
NCBI-ProteinID: XP_005802081
Ensembl: ENSXMAG00000004656
Position
2
AA seq 787 aa AA seqDB search
MAEAHQAVGFEFTVRPDGVDLKLSKEVIKNIYLSSLTAWKKKAIQLKNGILTEVYPASPS
SWLIVVIAMMMSLYTGTDPLLGIIDTIKESLPYKDCLSVQARAVLSAILLATAVWLTFIH
LIRFTLKILLSYHGWIFESHGKMRTSTKVWLRLLKMLSARRPLLYSFQAALPRLPVPRVN
DTIEKYLESVRPLLDDKQYKQMEMLAHNFKANEASQLQRYLVLKSWWATNYVSDWWEEYI
YLRSRSPIMVNSNFYIMDLLYMTPTHRQAARAGNIVHAMLQYRRKLERGELEPLRALGTV
PMCSTQMERMFNTTRIPGMETDFVLHLTDRKHLVVFHRGRYFQVWLYTGGRHLLPSELEN
QFQQILNDMSQPQPGELKLAALTAGDRVPWARTRLKYFSQGPNKESLDAIESASFFLTLD
EEPQGYDPGKVSSLDTYAKSLMHGKCYDRWFDKSFNLISYPNGKIGVNIEHSWADAPIVG
HMWEYVLATDCFHLGYTEEGHCKGDVNRGLPSPTRLKWEIPAQCQDVIHASYLLARHLAD
DVDFHAHLFTEFGKGLIKKCRTSPDAFIQLALQLAQFRDQGVFCLTYESSMTRMFRDGRT
ETVRSCTSEAVAFVRAMEDPDATNAQRLALFRKAADKHQNMYRLAMTGSGIDRHLFCLYI
VSKYLGVESPFLKKVLSEPWKLSTSQTPQQQLNLVDINKFPKHVGAGGGFGPVADDGYGV
SYIIVGENLITFHISSKFSRHNTNSTRFSQHIQKAMIDIQTLFKQDNDKNVVENGKDVHL
ENDKKNM
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcccatcaggcagtgggcttcgagttcactgtgcgccccgatggtgtggac
ttgaagctgagtaaggaggtcatcaaaaacatctacctgtcttcactcactgcctggaag
aagaaagccattcagttgaagaatggaatactgactgaagtttaccctgccagtccatcc
agttggttgatagttgtgattgccatgatgatgtccttgtacactggcacagatcccctt
ttaggaataatagataccatcaaggaaagcctgccttacaaagactgtttgtcagtgcag
gccagagcagttctgagcgccatactgcttgccacagcagtatggctgaccttcatccac
ttaatacgattcactctaaagatccttctttcctaccacggatggatttttgaatcccat
ggaaagatgaggacatctacaaaagtgtggctgagacttttaaagatgctctctgcacga
aggcccctgctctacagctttcaggccgccttaccccgactgcccgtccctcgagtgaat
gacaccattgagaagtatcttgagtcagtgcgccctctgctggacgacaaacaatacaaa
caaatggaaatgttggcacataactttaaagcaaatgaggcatctcagctccaaaggtac
ctggtgctaaaatcctggtgggcaacaaattatgtaagtgactggtgggaggaatacatc
tacttaaggagcagaagtcctataatggtcaacagcaacttttacatcatggaccttttg
tatatgaccccaacacaccgtcaggctgcccgggcaggaaacatagttcatgccatgctg
cagtacaggcgcaagctggagcgtggtgaacttgaaccgctaagggctttagggaccgtt
ccgatgtgttccactcagatggagagaatgtttaacaccactcgtatccctggtatggaa
acagattttgtactgcacctgacggaccgaaagcacctcgttgtcttccacagaggacgc
tacttccaagtgtggttgtatacgggggggcgccacctcttaccaagcgaactggagaac
cagtttcaacagattctcaatgatatgtcacaaccccagccaggagaactgaaactagct
gccctcactgccggagacagagtaccttgggcacggactcggcttaaatattttagccag
ggaccgaacaaggaatccctggatgccattgagtctgcctcattcttcctgacactcgat
gaagagccacagggttatgatccaggaaaggtttcctcacttgatacttatgccaaatcc
ctaatgcatggcaaatgttacgacaggtggttcgacaagtctttcaacttaatttcatat
ccaaatggaaagataggagtcaatattgagcactcttgggctgatgcacccattgttgga
catatgtgggagtatgttcttgcaacagactgctttcatcttggctacacagaggaggga
cattgtaaaggggatgtaaacaggggccttccttctcccactcgattaaagtgggagatt
ccagcacagtgccaagatgtcattcacgcttcatacctgttagccagacacctagctgat
gatgtggacttccatgcccatctgttcactgagtttggcaaaggcctgatcaagaagtgc
aggacgagccctgatgccttcattcagctggctctgcagctcgcacagttcagggatcaa
ggtgtgttctgtctgacatacgagtcatcaatgacccgtatgttcagagacgggcggact
gagacggtgcgctcctgcacctctgaggctgttgcttttgtccgggccatggaggatcca
gatgcaacaaatgcccagagacttgcactgttccgaaaagccgcagacaagcatcagaac
atgtatcgtctggccatgactggttccggtatcgatcggcatctcttctgcctttacata
gtatctaaatacctcggtgttgaatcaccgtttcttaagaaggtgctgtccgagccgtgg
aagctgtccaccagccagactcctcagcagcagcttaatttagttgatatcaacaagttt
ccaaaacatgtgggtgcaggaggtggatttggacctgtggcggatgatgggtatggtgtt
tcttatatcattgttggggaaaatctcattacattccacatctccagcaaattctccagg
cataacacaaactccactcggtttagtcagcacattcagaaagccatgattgatatccag
actcttttcaagcaagacaatgacaagaacgtggtggagaatggaaaggatgtgcatttg
gaaaatgataaaaagaacatgtag

DBGET integrated database retrieval system