KEGG   Xiphophorus maculatus (southern platyfish): 102219062Help
Entry
102219062         CDS       T02923                                 

Gene name
tp53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04010  MAPK signaling pathway
xma04110  Cell cycle
xma04115  p53 signaling pathway
xma04137  Mitophagy - animal
xma04210  Apoptosis
xma04216  Ferroptosis
xma04218  Cellular senescence
xma04310  Wnt signaling pathway
xma05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102219062 (tp53)
   04310 Wnt signaling pathway
    102219062 (tp53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102219062 (tp53)
  09143 Cell growth and death
   04110 Cell cycle
    102219062 (tp53)
   04210 Apoptosis
    102219062 (tp53)
   04216 Ferroptosis
    102219062 (tp53)
   04115 p53 signaling pathway
    102219062 (tp53)
   04218 Cellular senescence
    102219062 (tp53)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102219062 (tp53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xma03000]
    102219062 (tp53)
   03036 Chromosome and associated proteins [BR:xma03036]
    102219062 (tp53)
   03400 DNA repair and recombination proteins [BR:xma03400]
    102219062 (tp53)
Transcription factors [BR:xma03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    102219062 (tp53)
Chromosome and associated proteins [BR:xma03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102219062 (tp53)
DNA repair and recombination proteins [BR:xma03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102219062 (tp53)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P53 P53_tetramer P53_TAD
Motif
Other DBs
NCBI-GeneID: 102219062
NCBI-ProteinID: NP_001273218
Ensembl: ENSXMAG00000015716
UniProt: Q92143
Position
14
AA seq 342 aa AA seqDB search
MEEADLTLPLSQDTFHDLWNNVFLSTENESLPPPEGLLSQNMDFWEDPETMQETKNVPTA
PTVPAISNYAGEHGFNLEFNDSGTAKSVTSTYSVKLGKLFCQLAKTTPIGVLVKEEPPQG
AVIRATAVYKKTEHVGEVVKRCPHHQSEDLSDNKSHLIRVEGSQLAQYFEDPNTRRHSVT
VPYERPQLGSEMTTILLSFMCNSSCMGGMNRRPILTILTLETTEGEVLGRRCFEVRVCAC
PGRDRKTEEGNLEKSGTKQTKKRKSAPAPDTSTAKKSKSASSGEDEDKEIYTLSIRGRNR
YLWFKSLNDGLELMDKTGPKIKQEIPAPSSGKRLLKGGSDSD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggcggatctcacactgcctttgagtcaggacaccttccatgacttatggaac
aatgtgtttttgtcgactgagaatgagtctttgccccccccagaaggattgttgagtcaa
aatatggatttttgggaggatccggaaactatgcaggaaactaaaaatgtgcccactgca
ccaactgtcccagcgatttctaattatgctggggagcatgggttcaatctcgaatttaat
gactcgggcacagctaaaagtgtcacctccacatactcagttaaacttgggaagctgttc
tgccagctggcaaaaacgactccaattggagttttggttaaggaggagcctccgcagggt
gccgtcattagagcaactgcagtatacaagaagactgaacatgtgggagaagtcgttaag
aggtgcccacaccaccaaagtgaagacttgtctgacaacaagagtcacctgatcagagtg
gagggcagccagctggcgcaatactttgaggacccaaacaccaggaggcacagcgtgacc
gtgccctacgaacgcccacagctgggatccgagatgaccacaatccttctgagctttatg
tgcaacagctcctgcatgggaggcatgaaccggaggcccatcctcaccatcctgaccctg
gagaccacagagggggaggtgttgggcaggcggtgcttcgaggtccgtgtctgtgcctgt
ccaggcagggaccgcaagacagaggaaggaaacctggaaaaaagtgggactaagcagacg
aagaaaagaaagagcgctcctgctccagatacctccaccgcaaaaaagtccaagtctgcc
tctagtggagaggatgaggacaaggagatttacactctctctatccggggccgtaatcgt
tatctgtggttcaagagcctcaacgacggtctggaactgatggataaaacggggcccaag
ataaaacaggagattcctgcgccctccagtgggaagaggctgctgaaggggggaagcgac
agcgactag

DBGET integrated database retrieval system