KEGG   Xiphophorus maculatus (southern platyfish): 102219630
Entry
102219630         CDS       T02923                                 

Gene name
aff3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
KEGG Orthology (KO) [BR:xma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:xma03021]
    102219630 (aff3)
Transcription machinery [BR:xma03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     102219630 (aff3)
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 102219630
NCBI-ProteinID: XP_014323923
Position
7
AA seq 1241 aa
MPTVLGGKGKLSIVCLLLRYAYSQGKRSQHKCCAKDILEDMTQSWPSQQALGGEQTQRIL
YNPKDARHPAAQQRQSRGDTQQRMARHPYVAPHKSMLADDLKISSDEDDTQRAIHESASW
DRHSLSAQRAHTHGRRVRHSSSESSDSDSAESGSSSLRSHSPSPELHPDPPSPASAQPQC
NNKEIDHRSTTQWQLDKWLKRSKKKSARTDQDLPQAIAEPEASPLSQRAPSPARSWDSNQ
EYSPSQTPIPSPQFSYSNNNSPVPSPGYSYCPSPSPFPSTCPSPTSSPQNSPPPSPVLSV
CPSPCGTPRTSRSPSPIPNHLPRSPSPTLPTPSRGFHYHGGQNQNQLHSILTSTPHRTKI
RPWIAPLLGTSLKSKPPSNIHLQPSFQLKSKNHHTQDQVQSQSQSKLKDFGGLNSQLNPN
QKSIHKSTSYPRTKQFSNNPKTKNPTYFDQIQGNQSKSKPRPPFQQPSQQSPKRTKHVVP
TGCETNTAPSTHSTSASKATRNSVTGSTSGPFSNLIHWTKLWEATNSNPTHPNHAKTSQR
KPQSKEQEVVQRKHHLIQTERRIHESKEDRHHHEQQLGKLERKEDRRLAEEQLLRRPWIQ
SLPEEEEERATEQQGERKNTARGENRKKGEQAKEEWKAVRQVSSNDKPHHLRETLDCQGR
TKKGRRCEETREVIRDQLPLLSTHSPPPQRPSFNSSSSSLSSSSSTTPSNSDSESECLGS
ITKVSAESTSHRRVTKTGNQAASRPDTTRPKTVHSRRPSSDNPCERRQQSEAKQRLYTLV
PFGRGEKTPSTAQRGLRNLVVQIDLCLLKRVPDSPTDSTGKNLSPSKSSSLLKEKSKEAM
KHVYDLETSVTDGKRKRKLENGIGQRETKRSLLYLNEAPGQKEPSSLPAENIITETVHNG
YLEEFLDSKRPASPLSPLSPLPQSPEPIKPVSKTKTTTEQQQSRAQKSKDKSRDADVKPK
TEVECVKVSRQHQPPPESSWGPAGHRGSVPSQEISHHAEYYLHEAKRMKHRADAMVDKLG
KAVNYVDAALSFMECGKAMEEGPLEAKSPFTMYSETVELIRYAMRLKGHSGPGARQEDKQ
LAVLCFRCLALLYWQMFRLKKDHALKYSKVLLDYFKSSPKVPTTPPGWMDSGKATTGLPS
SLSPTAKHHRRGSNEGSSSASLISIPQRIHQMAANHLNITNSVLYSYEYWEVADNLAKEN
KEFFNYLNTLSGPLTLHSSIAHAVQYTRQALQWIRISAKLN
NT seq 3726 nt   +upstreamnt  +downstreamnt
atgcctactgtcctcggtggcaaagggaaactttccattgtctgccttttgctccgatac
gcatattctcagggaaaaagaagccaacacaagtgctgtgccaaagatattctcgaggac
atgactcagtcctggccttcccagcaagccttggggggggaacagacccagcgaatcctc
tacaaccctaaggatgcaaggcatccagccgcccaacaaaggcaaagccgtggggacact
caacagcgaatggctcgtcatccttacgtggcacctcacaaatcaatgcttgctgatgac
ctgaagataagtagtgatgaagatgacactcagagggccattcatgagtcagcttcctgg
gacagacacagtctgtcggcgcagcgagcgcacacacatggcaggagggtgagacattcc
agctcagaatcctcggactcagactctgcagagtcaggcagcagcagccttcgttctcac
agcccgagtccagaacttcacccagatcctccgtcgcctgcaagcgcgcagccacagtgc
aacaacaaggagattgatcatcgttccactacccagtggcagttagataaatggctgaaa
agatcaaagaaaaaatctgccaggactgatcaagatttgcctcaggctattgcagaaccc
gaggcctctccgctaagtcagagagccccctcaccagccaggtcatgggacagcaatcag
gagtatagcccgagccaaacccccattccaagtccacagttcagttacagtaacaataac
agcccagttcccagccccggttacagctactgcccaagtcccagcccattccccagcacc
tgtccaagtcctacctctagtccacaaaatagtccacctccaagtccagttctaagtgtt
tgccccagtccttgtggtaccccaaggaccagtcgaagcccaagtcctatacctaaccat
ctcccaagaagtcctagccccaccttacccactccatcaaggggttttcactatcatggg
ggtcagaaccagaaccagttacattctattctaacatctaccccccacaggactaaaata
agaccatggattgcaccattgcttggcaccagtttaaagagtaagcccccgagtaacatt
catcttcaaccttcttttcagctcaagtctaagaatcatcacacacaagaccaagtccaa
agccaaagccaaagcaagttgaaagattttggaggcttaaattcccaactaaatcccaat
caaaaatctatacacaagtctacttcatatccaagaactaaacagttttccaacaacccc
aaaactaaaaatccaacatattttgatcaaattcaaggcaaccaatccaaatccaagcca
cggccaccatttcaacaaccttcacaacaaagccccaaaagaacaaagcatgtagtcccc
actggctgtgaaaccaacacagctcccagtactcattccacatctgccagtaaagctacc
agaaattctgttactgggtcaacctctggacccttctctaaccttatacactggacaaag
ctgtgggaggctacaaactcaaaccccacacatccaaaccatgccaaaacttcacaaagg
aaacctcagtctaaggaacaggaagtagttcagagaaaacatcatctgatccaaacagag
aggagaatacatgaaagcaaggaggatagacatcatcatgaacaacaactagggaagcta
gaacgaaaggaagacagaaggctggcggaggagcagttactaagacgtccctggatccaa
agtttgccagaagaagaggaggaaagagcaacagaacagcaaggtgagagaaagaacaca
gcaagaggagaaaatagaaagaagggggagcaggcaaaggaagaatggaaagcggtcaga
caagtgtcttctaacgacaaaccacatcaccttcgagagactttagactgtcaaggcagg
acaaaaaagggaagaagatgtgaggagacgagagaagtaatcagagaccaattaccccta
ttatccacacactccccacctccccagagaccatccttcaactcctcctcctcctcatta
tcatcatcatcttctacaaccccctccaactcagactctgaatctgaatgtcttggctct
atcaccaaggtttcagctgagtccacttctcacaggagagtcaccaagacagggaaccaa
gctgcaagcagacctgacactaccaggcctaagacagtacactccagacgacccagttca
gataatccatgtgagaggaggcagcaaagtgaggcaaagcaaaggctctacacactagtc
ccatttggacgaggagaaaaaactccttccactgcccaacgggggctaagaaatctggtg
gtgcagatagacctctgtcttctcaagagagtcccggacagtcctacagattccactggt
aaaaacctatccccttccaaatcatcttcattgctgaaggaaaaatctaaagaggctatg
aaacacgtttatgaccttgagacttccgttacagatggcaaaaggaaacgcaagttagag
aatggcataggtcaaagagaaaccaagaggagtcttctttatctaaacgaggcaccaggg
cagaaagaaccttcatcattaccagctgagaacatcattactgagacagtgcacaatgga
tacctggaggagttcttggacagcaagaggccagcgtctcccttgtctcccttgtctcca
ctgccccagagtcctgagcccatcaagcccgtctccaaaacaaagacaactaccgaacag
cagcagtcccgtgcacagaagagcaaagacaagagcagagatgcagatgtaaagcctaag
actgaggtggagtgtgtaaaagtatcaaggcagcatcaaccaccacccgagtccagctgg
ggaccagctggtcacagagggtctgtaccaagccaagaaatttctcaccatgctgaatac
tacttacatgaagctaaacggatgaagcaccgtgctgatgcaatggtggacaagctagga
aaagctgttaactacgtcgatgcggctctgtccttcatggaatgtgggaaggcgatggag
gagggaccactcgaggcaaagtctcctttcaccatgtattctgagacagtggagctgatc
cggtacgcaatgaggctcaaaggtcactctggccctggagcgagacaggaagacaaacag
ctggcagtgctgtgtttcagatgccttgccctcctttactggcagatgtttcgcttaaaa
aaagatcatgcactaaagtactccaaagtgctacttgactatttcaagagttctcccaaa
gtgcctacaacgccacccggctggatggactctgggaaggctacaacaggactcccgtcc
tcactgtcacccactgcaaaacaccacagacggggttcaaatgagggcagcagctctgcg
tcgctcataagcataccccagcgcatccaccagatggcagcaaaccacctgaacatcacc
aacagtgttctgtacagctatgagtactgggaggtggcagacaacctcgcaaaggagaat
aaagaattcttcaattacttgaatactttatctgggccattgactcttcacagtagcatt
gctcacgctgttcaatacaccaggcaggctcttcagtggatacgcattagtgccaaactg
aactga

DBGET integrated database retrieval system