KEGG   Xiphophorus maculatus (southern platyfish): 102219802Help
Entry
102219802         CDS       T02923                                 

Definition
(RefSeq) titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
KEGG Orthology (KO) [BR:xma00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xma01001]
    102219802
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xma04131]
    102219802
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:xma04812]
    102219802
   04147 Exosome [BR:xma04147]
    102219802
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102219802
Protein kinases [BR:xma01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   102219802
Membrane trafficking [BR:xma04131]
 Others
  Actin-binding proteins
   Others
    102219802
Cytoskeleton proteins [BR:xma04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     102219802
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102219802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 I-set Ig_3 ig Ig_2 V-set Pur_ac_phosph_N fn3_2 C2-set_2 Pkinase Receptor_2B4 fn3_4 Ig_6 Pkinase_Tyr THB Ig_5 Ig_4
Motif
Other DBs
NCBI-GeneID: 102219802
NCBI-ProteinID: XP_023192916
Position
7
AA seq 27577 aa AA seqDB search
MSTQAPTFTQPLQSVVALEGSAASFEAQVSGFPVPEVSWFRDGQVLSAAALPGVQISFSD
GRAVLSIPAVTAAHSGRFSVRATNGAGQATSTAELLVTAETAPPTFIQRLQSSTVRQGSQ
VRLSVRVSGIPTPVVKFYREGAEIQSSADFQILQDGDLYSLLIAEAFPEDSGAYSVTTTN
SSGRATSTCELLVQGEEAVPIKKTKTIMSTSQMEMSGTTVERKSMEASFQATTMMEMHVE
GGIMTQHIAHKTPPRVPPKPTSRSPPSFVSKVTGGRQQSPSPVRHVKGPTPAPVRPVSPS
SRMSISPIRPVRSPVMTRKQVSGSAEVLPPWKQGDYMAEGYTSMTSMTSMSSISSSTQLH
MEKQWEHQVAATRETEGEKKAEAVATVLAAVDLARVRQPIHEEGVWAGEEEEEEEEVLEV
KQKAAVITDKQVVAAKTKEQRQVQIQEVQQIHQIQKTAEVSSHVDTGVAPSTVPHFMVSK
VSVPKHETSREVSITGSAIAALHKELASPSATRKIIKPVKSPSPSRRSVVEARVTLEPLP
PPFKDIRYQRQFEGGAYAVSEEEFEDWEPQEAVAVPMRAQEPAVPPTIMAGLKNLTVTEG
ESVTLECQISGQPAPIIMWFREDYKIESSIDFQISYENGVARMMIREAFAEDSGRFTCTA
TNEAGTISTSCYLLVKVSEEIESREEMVTVTETGLTQAKTIAVEMREQAEISAGESAAPF
FIKKPTPQKLVEGGSVVFECQITGNPRPHIIWKKSGVPLTTGYRYKVAYKKETGECRLEI
SMTFADDAGEYSVFAKNPLGEASATAILLDEEQYEAYMKQQDVTYKTEVTTTVVQEPQPV
VAQYEFEQRRVTTPMSFVSETEFMISAFEERIIQEIEIRILRITYRELVTEDGELMVTVA
EEEALQPAFETPVKNYRIMEGMGVTFHCRMSGTPLPKIVWYKDGQRIRPGGRYQMEVLQD
GRASLRLSVVQPEDEGVYTAFASNMKGNAVSSGKLYVEPSGGVTPPSYTPQPSMQRIRST
SPRSLSRSPGRSSSRSPGRSPARRLEETDEIHLERLYKPVFVMKPSSIKCAEGQTARFDL
KVVGRPMPETYWFHNGQQIVNDFTHKIVIKEDGTQSLIIVPAVPKDSGEWTVVAQNRAGR
TSVVVNLSVEARESVSRPQFVEKLKNITVKQGTLVELAVKAIGNPLPDIVWLKNSDIITP
SKHPHIRIEGTKGEAKFQIPSSAGSDSAWYTATAINKAGRDTTRCRVNVEVDHSAPQAER
KLIIPKGTYKAKEIAAPELEPLHMRYGQEQWEEGDLYDKEKQQKPLFKKKLTSIRMKRFG
PAHFECRLTPIGDPTMVVDWLHDGKPLAAANRLRMVNEFGYCSLDYEVAYARDSGVITCR
ATNKFGVDQTSATLIVKDEKGLVEESQLPEGRKGAYRMDEIERIAHEGGPTGVSLDDESE
KTKPEIVLLPEPARVLEGDIARFRCRVTGYPAPKVNWYLNGQLIRKSKRYRLHYDGIYYL
EIVDIKSYDSGEVRVVADNPLGTTEHTVKLEIQQREDFRAVLRRAPEPKAAEVPHESGKI
GFDIVKVDRPGEVPQDREVVKLRKAQRIVHEKTSEESEELKSKFKRRTEEGFYESISAVE
FKSRKRDDSYEDLLKKTKDELLHHMKEMEEAERRRMEEQGKITIPTIKPDRIQLSPSMEA
PHILERIGSKTVSPKDEVRFSVRVVGRPEPECQWFKNGILLEKSDRIYWYWPEDHVCELV
IRDVTVEDSASIMVKAINVAGESSSHAFLLVQAKATISFIQNLADASANEKDTMVTFECE
TNEPFVKVKWLKNNVEIFSGDKYRMHSDRKVHFLSVLVIEMSDDAEYSCMVIDDENIRTN
ARLHVEGAALELNKHLENIEVPESYAGEFEVEVSREDAEGKWFFGEKELSPSSKYVISSR
RGRHTLAVKDVRKDDQGKYTFVCGDLSTSASLKMKLRPVTLMQPLTDLTICEGDIAQLEV
RFSQENVEGAWLKNGQAISASDRVHIVIDKQVHKLLVENVSREDAASYSFVVPTHEISTS
GKLNVQTIDIVVPLKDVSSTEGTKAVLESKISAQDISSIKWYHNDKLLIPGDRVQAVAKG
TKQRLAFTRTFASDEGRYKLVVGKVETSCNLTVEQVHIVKHMEDKVCSESQNVTFNVEVS
HPGIDPLWTFRNQQLKAGPKYKMESKGTAHSLIVLDTMKDEEGQYMFHAGEKTSSAQLTV
SGGAITRPLQDVTVAESQTSEFECEVANAEAEGKWLKDGQLVNFNENVVSEVNGSVRRLV
IIITRPQDVGEYTYQVANSKTSANLKVEAVKIKKTLRNQTVTETQEAMFSLELTHPDVKG
AQWIRNGVELQNSDKFEIISEGTIQTLKVKDCNTQDETVYSFKLGKLSATARLNVETIKI
VKKIKDVKSLLDGTASFELSLSHDNVPVRWMFKGVELKASEKCKILSERKAHKLILQNVD
SSNAGEYTAVIGHLHCSAMLTVEALCVTKPMKSVEVPETQVATFECEVSHFNVPSTWLRD
GVEIEMSEKFRIVVQGKLHQLKIMNTSREDSAEYTFICGNDRVSATLTVNPVLITSMLND
LNAQERDTITFEVTVNYEGITYKWLKNGVEVKSSERCQVRSRQLTHSLTIRNVHFGDGGE
YQFVAGSAASAANLFVEARVIEFTKKIKDIKITEKKKAMFECEVSEPNIQVMWMKDGQEL
DLTEERYVVTAEKFVHRLMIQTVRMSDAGEYSVVAGSSVSKAQLIVEGRDVRIAEPAERE
IMVLEKHRATFEFEVNEDDIEGRWLRNGVEIQFSVEERFSYVAIRKLHRLTISETYRSDA
GEYTFIAGKNRSTMHLRVNIPEPPQILRHMEPQSVEAGKPARFSVQVSGVPPPQVSWYKN
SQALSPGFKCKFLHDGNEHTLLLIEVFPEDAAVYNCEAKNDYGTATSTATLNVEVSEVVS
PDSAAPIAPPVIISPISNTSAREGESAYFQCRVRGDDVKISWFHKEKEIKQSDFFRMSQF
DDSCQLEISRVYPEDEGEYTCVATNNAGKVSCSATLTLDGQIQTVSSSTEPQWHISSLKK
PSVGQKPVFIQPITSCTVTHGEVARFHACVSGLPKPEISWFHNRQPVQPSKNVVFHFDEV
TNIATLIIVDAFSEHAGQYTCKAVNNAGEAACSASLTVIREEEVTLVREQIEATVEEEVK
ERSSTTITTVEEREETFYTGVQLPQKSKTLELKPEPKRYSSTLEKKKEKPVFLSQLSPAA
VTSGETARFTVRVSGFPKPIVQWSRNGRVIKSSSAYRLVEEKEEYTLVITKVTSEYEGEY
SCTATNRFGQTTCTTYLEVKKPDISQAERWVEKMFKVTGQPPTFTVQIQPVRCSEGGEVY
FNYKTTGDPVPDVKWLKGAFQIQPSRNCIIVTNPDGSGLINIKSVKQEDSGLYTCKASNQ
FGEATCSAELVVFRESVSVSHKKEQLTMVQKKSYKVSVSEQATESRLYQVSLPGQDKTRS
DQMVYTIGTEDRKIIPSEQVASLGEADISAATIHRETLTQQAAVLQTHEIEERVSVVPTH
PPQASAVPGKQLHMAAFTSSVEESQGLTEQHCDRIQSPEVIELQLAREKQSKLMSAMAEE
LIPLSTVSTELLHDKQPANIKPTSEPKHLVSGHQVESQLSIVREQSEDIPGQQQEKSYRV
KEGIKILYSAQSTEKQVMEEGHTTELSTAESAVKSTIKKEQSQPILASISESKQTLSKET
GFSIQMPAEEAAQLSKDRIMKAALNAEERQILQAEPTKELPCLDRAVTIQSHVESGKVLH
LQVITDQDLLSSEKSFSSEKPAPEQADTRKSPTLLHTVSQDQQKTVFCEDISEFETKASS
IAIQPQNEAQTVLHLQSIMPVEVLPKEGVFTDEKPDEQVATQKHEKSRSHAAVSEERREL
TADYHSELDLSVTGVQSNIRTEPKPQKILQVSYQPMQLPKETPIAVDLKHQKALVQKEDR
WNVMHVTSVADSQVLEEGHTETLSGVDKFKCLTTIEPKMPTEPVQIEEKEISTESSISLE
AAEQDFAVQIQEGQSVRQSIVMDEKRVLTGELSQEISKSESTKVIVSTQPKLSLMASESK
DSTALPKEMMFVIQIPKPSSLNIRHQLREALQSAVASDQPVLLADVVGKLQALEVQEVKV
QREPKRSMFTYLITTTGAPIEITLAFEGEYPQKADLRTELQAAFHSIVYQEAHVLTSEQP
GTMQLDKPQRAHVSSARSGQMLSTVVESVRVAESTVDFTAAKSQAAALKIESDVTVECAA
EGGQVVIQESKTEKVEKSISSKTKITTETQVAFEQSVQVSRKEIRSVMVESEEKEVGTAF
VTTALPLATIPTEQTLDVSIQQKHREEIFKEEVTLSRPEQREYPEIVTSLLDLATEEDGE
VTFITTIKFATKVSWFFNGQLVKSGKEFKCFKDHDTYSLVINKVVKERHQGEYVCEAENE
AGRTTTSSRLTVVPRVPPVFRQKINPVEINVGGHAKFDCETEDAPNVTFKWYKSNIEIKQ
SEKYRIISRHTGSSLELLNPVKTDSGEYTCKASNQHGFDSCTASLIVTEPAKIVDKPETL
SVTAGDMAALEVKVCGTPELVPKWFKDGMELATSGKYKISFSQMISSLNVLSTEKLDSGE
YTFQVMNQVGKDLSKINLTVLDKTVPPSFTRKLKDYKMTVGEAAEMECKVSGSPPFTISW
YHDGEEIQSGPNCEVSFSDNSCTLRVPTLKMTDSGVYKCKAINKAGFSETSATLAVKEPP
SFVVPLQPMEAMPGSNVTFSGMVKGSAPLTLKWFRGTKEILPGKDCSFTLKDNQVTLELH
NVNRSHAGEYTCQIINDAGKESCAVNLTIKEPAAFSKKLKDVSVEKGKPLTLECSYTGTP
KITVSWFKDGQQIFASYKYNITTTESSCILECLSTDDKEAAGTYSCQVSNDAGKDTSEAV
VSILEPPYFVESLEPMEVTAGDAVCLKCQVAGTPEIKVSWFKADGKVRSSSSCKLEYSKG
VASLKLSKATKADIGEYTCKAENKIGSASSTCRLNVLEAKTPPSFPKKITSLQETEGQAV
RFECRVAGSSPIEVSWLKDGEPLMQGGEFSMLYDDNTAVLQISRGEMRHSGEYTCVATNS
VGSTSCRAKLTMQEPRYAPVFDRKLSPREVTVGDSIEMECHMTGSAPIKVTWSKDHKDIR
SGGNYKISCVENTAHLTILKADKGDTGKYFCHASNDMGKDSCSTDISVKERKNPPMFTKK
PSEHIEDMEGKLVKIEGRVSGSQPVSVSWFKDGKEIHSSDKYDISFKSNVAVLCIKSSQV
TDSGRYSCQASNEAGRASCDITVGILEAKKPPVFDVPLKPVTVDEGDKLSLRCHVCGSAP
LKVQWMKDRKELSSAGSIRLGFSDGTASLEISSASKHDAGDYLCKATNEAGAEFCKAKVT
VKEKPGAAKPETPAAAPTKKLDNLFFIEEPKSMHVTEKGTATFIAKVGGEPIPSVKWMKG
KWRQLTHGGRISIVQKGQESKLEIREVTKSDSGQYRCVASNKHGEIECNADMHVDGKKEA
PQLEGDLRAKLKKTPSKQKSPQEEKDIDIVELLRNVDPKEYEKYARMYGITDYRGLLQAI
EQLKKERGEESGRPEVERGDRESDEDMARLVADLQKRMERTEPVTVVKDISNQSVFTNEE
AVFECEIKINYPEITLSWYKGTQKLDTDDKYDISISGDRHLLKIKRCQPSDQGNYRVVCG
PHISSAKLTVTEVEVEKHLQDTSGKEGQACTLSCQLSVPNVEAQWFKNGKQLEMKGRYSS
EVKHKVQKLLIKDLKSEDRGRYSCRYQHLESSADLKVEAEQIHFTKRIHNVEVNERQSAT
FECEVSFDNAIVSWYKDTWELKECTKYNFRSEGRRHFMVIRNVTIEDEGVYSVIVRLEPR
GEAKSTAELYLSGKEIELAMVPTDFPDSSVQRPEVPSSEEIQESAEFYQYEEKIEQRESA
EYSYQYEEEVQQKVEYQSWTEETVTQQISETKAARVAVEEKVETMKVEVREEIPAKVEKK
PEEKPTAAVEEPKKKPEARKPVEEKVPAVSVPEKKEVSAPKEPEDVKKPVAAPKEKPGLP
TKDEAKPQVPAEPKKPVPEAKPKAEPEAKPAPTPKAEPEPKAKPAPAPKEEPEPKAKPAP
APKEEPEPKAKPAPAPKEEPEPKAKPGPAPKVEPEPKAKPATAPKVEPELKAKPAPAPKE
EPEPKAKPIPAPKVEPEPKAKPAPAPKEEPEPKAKPAPAPKVEPEPKAKPAPAPKVEPEP
KVKPAPAPKVEPEPKVKPAPAPKAEPEGKPVIPPSKDETKGPVQTPGGVQKEGQPAEEAG
RGRGRGLKPKQTPSPGEGRGRGMKPGGRGGPTPPEEPFAGFKLKAVPLKFIKKLENIVLK
EAESIGSSAVFECEVSPSTAITSWMKDGGNLRESPKHKFTSDGKDRKLHIIDVQLSDTGE
YTCVAKNAGKEISCTAKLIVEELPVKWIKELEPENSAILGQPIYISCELSKERDVVWKKN
GEVLKKKEGKIQINIIGLQHAVTIQGSTLEDAGTYTCEVSGQEDVVTTTNVKVLGRVISL
VRPLRNITVTAGETATFQCELSYEDIPVDWYLGDTKLESSDRVVFKDEGKTYSVTVRDVQ
LSEAGQVKLIAKDFETEATLSVKEPPVEFTKPLQDQTVEEKTTATLECEVSRANGEVQWL
RDDQEIRKTKKYEILAEGCKRTLVIQDCTLDDSKTYTCDAKDFKTSCFLTVEAARVEFSK
PLHDVEVREKESARFECEVSREDAKITWLKDGTEIRKGKKYEIIAQGRQHILLIHKATFD
DEAEYECDAQTSKSSGMLTVVEEETTFTKNLPNVEGTETDSVRLICEVSKPNADVTWYKG
DKELPDGGRYEHIVDGKKRILLIKDLKTDDAGEYSCRLSTGTKTSGSLKINELAAEFLSR
PQNQEVVEGHRAEFTCIVSKETFSVKWMKDGNELESGDKYELVSDGKKRSLVIKASELKD
EGGYVVVIGETRASADLTVSAKLKVITPLRDTEVKEGQEVVLNCEVNIDGAKAKWLKNEE
TLFESGKYVMVQRDNVFSLRIKDARKGDEADYSITLTNQRGEQAKSSGKLSVREESLKIM
VPPEDIDTQEKKTISFSCKTNRPNATVKWMKAGQEITFSKRVVYRVDKEKHTLTIKDCTL
ADEGEYTVVAGDNKATAELIISEAPTDFSAQLKDQTITEFDDAEFTCELTKEKAEVKWYR
NGREIREGPRYAFVKDGKFCTLRIKECRPDDECEYACGVDDKRSRARLFVEEIPVEIIRP
PQDVFEPPGSDIVFEVELNKDRVEVKWLRNNMTVVQGDKFQMMSEGKLHRLQVCEIRPRD
QGLYRVIVKDKDAKAKLELAAVPQIKTTDQSYVTDAGKPIVLAVPYSAYPQAEADWLYDN
QSVSKDNIYTSAERTEYRLKDPKKSDQGRYKIVIKNKHGQGEAFINLDVIDVPGPVKNLQ
VVDTADGEVSLAWEEPENDGGSKVISYVVERRDVKRKTWTLATDHSESPEYTVTGLQKDS
FYFFRVSARNRVGNGPFVETDEAVQAKNKFDVPEAPLNVDVGNVTKFGCTVSWDPPVSDG
GSPITSYIVELRDRTSVKWSPVQVTKAGELSAIINDVIENKEYIFRVKAENKAGEGKPSA
ASRPVKIMDPIERPSPPQNLTWQDQNKSSVQLTWETPLKNGGSIITGYIIERCEEGTNKW
LRCNARLCPDLFYKVSGLKYGTKYNYRVFAENAAGVSEPSNVIGPLLADDPHFAPSFDLS
AFKDGLEVIVPQPLTIRVPITGYPTPVAKWTFGEKELTTADERVSLMTKSTFTELMITPS
VRPDKGIYTLHLENDVTSVSGDIEVNVIAAPSAPKDFKVLEVTRQHVHLSWEAPEHDGGS
PLTGYQVEKRDVSRKTWVKVVSGIQDLEFTVTDVVEGKEYLFRVTACNKCGPGEPAYIDE
PVNVSSPATVPDPPENLKWRDKSASGIFLTWEPPKYDGGTGIRGYNVERCQRGTDKWEPC
GDTVPELKCQVTGLIEGEWYAYRVRALNRLGASRPCKPTDEIQAVDPIEAPEIQLDAKLL
AGLTAKAGSKIELPAEVKGKPEPRVKWTKADLVLKPDDRVSIDTKPGHSTVTVAKTKRDD
SSTYIIEATNSSGRATATVDVNILDKPGPPAAFDISEITNETCLLAWNPPRDDGGSRVTN
YIVERRAVDSEIWHRLSSTIKQTTYKAVGLVKFKEYIFRAFAENQFGVGPPAEHPPIIAR
YPFDTPGAPYKLEPSDIAKDAVTLNWYEPDEDGGSPITGYWVERYEPDHDKWIRCNKLPI
KDTNYRVKGLPTRKKYKFRVLAENLAGTGKPSKETDQILIKDPIDPPWPPGKPTVKDVAK
TSCFLTWTKPEHDGGAKIDSYVIEMLKSGTTDWIRVAENISILEFFLKGLMEKQEYSFRV
RAINVAGESEPSEPSDPVLCKERLNPPSAPRWLEVVSISRSSADLKWTAPERDGGSRITN
YIVEKRDAKRKGWQAVDTTVKELKTTVTPLNDGALYVFRVAAENAVGVGPFCELEDSVLA
KDTFTTPGPPYALTVYSVTKKYVDLEWEAPKNDGGRPILRYSIEKKEKLGTRWVKCGKTS
GPDCKYRVTDVIEGTEVQFQIRAENEAGVGHPCEPTEILTIEDPTGIPSPPIELHVTGAS
RDFLSIAWKPPQQDGGSPIRGYHIEMCEAGTEKWMRVNSRPVKELKYRVEEGIVPEKEYI
LRVRAINSVGESEPSDISENVFAKDSDCNPTLEFQTLDLVVVETEKLHIPVPFRAVPSPK
ITWHKDGKELKADERLMFRKEYTSCHLEIDSSLHPDAGVYKVTLENKLGSASATINVKVI
GLPGPCKEIVASEITKSSCKVSWDPPDYDGGSPILHYVLQRREAGRRTYVNMMSGENKVS
WMVKDLIPNGEYYFRVQAVNKIGGGEFIELRNPVIAEDQKHAPDAPVDVETHNPTSSTIT
LTWKPPMYDGGAKIMGYILERQQKGEDKWERCNDFLVPVLSYTVRGLTEGKNYMFRVKAE
NAAGISDPSRNTLFVKASDAVDPPKVFLSGSLQSGLSVKRGCEICLNANISGSPYPQITW
YWNNQVIQPEPLRKRPEKPLKKKPEKKEEEKKEGEEKKEGEEKKEGEEEKKPEGEAETKE
EKKEGEEKKEGEEKKEEEKKPEEEAAEPEVEEPDYPTINERLTIDNSHRGVSSIVINESV
RPDHGVYMVKVENDHGIASATCEVNVLDTPGPPVNFRFEEVRKNSVICKWDPPLDDGGSE
ILNYTLEKKDNSKLEFGWSCVTSTLRGCRYLVPKLIEKKEYIFRVVAENKFGPGTPCVSK
PLIAKNPFEPPEAPDKPQIDDITANSMLVTWDVPKDNGSPILGYWVERREINSSHWARVN
RNIVPDTELNVEGLLEGLTYIFRVAAENQAGPGKFSPPSEPKTAQAPILPPGPPIARVVV
TTDHSIEVEWDPPADNGGGEIQGYHVDKAMAGTKDWSRSTERPWKQRNFTVYGVREGAKY
TVRVIACNAAGEGTPGFTDAVFVRNPAEIPVIDMDLAIKNGIIIRAGETLRVPATVTGKP
YPSITWTKDDGKPDKDRVELLSEGNDSVVSIKNVQRQDCGKYQISACNPSGSKSASTRVE
VMDVPGPVKDLKPVVVTRKMIFLNWDDPEDDGGSDLTGFLVERRDAKMHTWRQPVETASS
KCECVGIMEGQEYFFRVIAKNKYGLGVPVELGPIKAVDPQGPPSYPEKFHYTERTKNSIT
LAWKPPRSDGGSPVIGYFVEKKRQDQQAFEPCNTEICPNMTLTVEGLEEAWMYEFRIKCA
NLIGESEPSIPLTVVIQDDEVGPEVHMLKHFTADCITVKKGEPIEIPADIIGLPIPKIEW
SKDDVLIDKPTETLLMETEVTGRLNAKTTLSIPAANRRDRGSYTVSASNNMGSAKHTVYV
MVLDRPTPPRNLAVSNIRAESCYLNWDPPVDNGGSELTNYIIQRKEVRKDQPEPEEGEEA
PPEPQWEVVNNAVIERKLGVWELDTSKTYLFQVRAENKYGISDPCTTEEVLITDPFGLPG
PPQKPAIAEYSKTSMTLTWEPPRETGGSMITGYWLEKREKGTDYWAKVNKTPVTKRGTKG
WEYQVTRLFEGTEYEFRVAASNSAGTGPFSGPSDSAFAVDPITPPSMPAAPEVADKTKHS
VTLSWKPPESDGGSPIKGYIIQIQDEGSSEWHKINDIDSLHPTTEFTVPSLRELKRYRFR
IIAVNDIGESDPSPRTSEVLIEDVQLPPVITIDVMAEELVNIRAGDPIRIPATIKGRPAP
KVTWDYEGKAKSEKKNKLHTIPVEAQVESTDTTSVVNIPVSLRSHSGRYTITAKNKSGQK
HVNVRVIVVDVPGPPKDLKVTDVTRSTMRLIWKLPDTDGGERIKSYFIEKKSVIDKAWTK
VNAACASQAFVVPGLLEGQDYLFRVRAENRLGFGPFTETTEPIRARDPIYPPDPPTKLKV
NLVTKNTVTLSWEPPKNNGGSPVKHYIIERLSWDTSSKEKEAWKQCNKRDVEELTFIVED
LKEGGEYEFRVKAVNAAGPSRPSATVGPLVIKDQTCPPTIELREAMEGEEGCDVSIVARI
SGCPFPTLTWHKASLAKPEEKAAVQYDQHINKLVTPDKCTLLIQQASRNDSALYSLTASN
SLGTVSKDIKLAVLGPPGPPVGPIKFTEVFAERIGLAWNPPTDDGGSKITNYVVEKREDN
RKTWVHVSNDPKECAFVVTRLTENHEYEFRVMAQNKFGVGPAVISEPEKARNLFTVPGQC
EKPTVTEVCLESMTVNWDEPKYDGGSPITGYFVEKKETTSKRWTRVTREPIRALPLGNNW
DVTGLLEGALYQFRVIAINAAGCGLPSLPSDPVLCRDPIKPPGPPYPKVMDWTKSTVELE
WLPPSTDGGSKVTGYIVELKEINKEEEEMKAKRRLLLSEAEEEKEPESDESWKKAKDTEI
RGTKFVVTDLKEGGLYQFRVRAVNSAGVGDPGLVSELIEAKDRTIPPEMDLDASVKEKIV
VHAGATIRIIAYVSGKPAPQITWCRDDAEVPKEAVVETTGISNSLVIKNCRRQHQGMYTL
SAKNEGGERKKAVIVEVLDVPGPVGLPFAGENLTTDSCKLTWYFPEDDGGSAITNYIIEK
RESDRMGWTSVSYTVTRNNAVVQGLIEGKGYFFRIAAENIIGMGPFIETDKMVLIKDPIS
VPERPEDLIVTGVSKDSISVAWRPPKYDGGAEVTSYVLESRMVGRDTFTRIGGEDKLMDR
KFTLTGLKEGSSHEFRVSAVNQVGQGKHSFPTKPVQCKDELEPPTLDLDFRDTMMVKVGD
PCMLSGRYSGKPAPTITWTKNDEELKSDEEINLHSTARHLSLNISKAKREHSGRYCVSVE
NAAGPRTGICTITVVDRPQPPEGPVVFNEVYRNYMVISWNPPLDDGGCAISNYIIEKRDT
NRDLWMPVTSSSTRTSCKVPKLIEGREYIIRIMAQNMYGISDPLLSAETKARDVFKVPDA
PKQPTVKEVYHDCALISWEPPADGGKPITGYIVERKETKASRWVRCNTERIYPKVEYCVM
ELLQGCEYEFRVSAENVVGAGDPSPPSKPVFAKDPIVKSSPPVNLCAIDFTKESVTLSWE
PPTDTGRGKIFGYLLEFQKAGQEEWSKVNQTPDSCQETRFKVIDLEDGALYRFRVMAVNA
AGESDPTNLKEPIRVQERLEPPELILDAGMAREVKAMAGTHITLMATIKGVPFPTVTWKK
NDAEVPTRADIETNQAGTKLEMRFCNRGDCGDYTLTVENSAGSKTATCTVLVLNKPGPIQ
HLRVSDVRSDSAYLSWKDPEDNGGSRITNFVVEKKDTASTQWVPVCSTSKKRSMMLKHLM
EGTSYSFRVAAENHYGRSEFVETPKAIKAMNPLFPPGPPKDLHHADVDKTEVWLAWNWPD
RDGGSEITGFFVEYQEEGAKEWEEWKTVSIPESHVTGLEEGKTYRFRVRTENAIGLSRPD
TTLPILCQEKLVPPIVEVDVKLIEGIIVKAGTTIRLPAIMRGIPVPSAKWSIDGEEITSQ
GNIKIDTDNFSTVLNINECTRNHTGTYLLTVSNAAGTKTVALSVTVLDVPAAPIGPVNIM
EVTPDSMTIEWRPPKDDGGSPVTNYIVEKRESNKETWGGVSSGSLETQLRITRLQKGTEY
VVRIRAANKMGVGAPLESKPTVAEHTFMPPSPPGKPQHYELSEDAVTIGWTMPLADGGSQ
ITGYLIERRHKGGKWIRVNRTPCKDLRYRVQGLFEGSEYEFRVFAENIAGYSGPSPTSDP
CKPCRPISVPSSPINPKVKDYSKNTADLVWTKPSKDGGSPILGYTVEMKKADTEDWKKVN
LDDLIKLCAYRVKGLEEGVSYSFRVYASNMIGDGEPKEMPQSITAQDILIPPEIEMEATC
RDRLTVRVGHNINIIGYIKARPDPEVIWSKEETVMENSKRVTIIQNLPVVHLRVKEATRN
DHGKYTLKASNEGGEASCTITVNVLDRPSHCQNLHITYATKDSCMVNWEAPIDNGGSEIT
NYIVECREPSISMWSMISSNCTNRKIKAKLMEGHEYLFRVCAVNKLGPGPSVEIKTPLLA
IDPIEKPGEPENFRATDIGKNFVYLRWRKPDYDGGSPNLSYNLECKHKDAEQWEKLNTST
LTDTFFLAAKLVENQTYTFRVQTVNEGGESAWVKIPDIVVREEIQKPVIDLKVAGIVTVK
AGESVRMEAALRGKPQPEVKWTKDKAVGDNPRMSYETGSDYSKFLLTKSRRSDTGKYVIT
ATNTAGTFTAYANVNVLDVPGPVRNLRITGIGADKCRVVWDGPEDDGGCEVDSYILEKCE
TRRMVWSTYSASVVTPYCNVTRLVEGNEYIFRVRAENKMGTGPAMESRPVTVKTQFNRPG
PPDTPEVTKVSKEEMTVVWAPPENDGGKSITGYILERKEKRAVRWVACTKSPISERRMKV
TNLIPNHEYQFRVKAENEVGLGEPSKPCRPVAAKDPIEPPGPPAGLKVSDSTKTSITLSW
SKPVYDGGAPIIGYSLDLRLKSDADPEKPSEGWKRIDTRGPLVITEFTIGQLDEKQEYEF
KVSAQNQVGWGRHAYLKEAVSPKEILEAPEIELDASLRKGLAVRAGCPIRLFAVIRGRPA
PKVTWKRLGVDNVIRRGHVDQVDTMCFLVIPESTREDSGRYALTLSNSAGEKAVYVRVKV
LDTPGPVGGLDATNITKTTAQLSWLPPENDGGSPIINYIVEKREVDRKTWTKCIEDLKKT
SFKVTSMTPGIEYYFRVMACNKYGIGVPQDSPRSYLAVDPISEPDPPKKMDVLEISKNSA
TLGWLKPLRDGGAKINGYVVDYQEEGAPEDKWTPYSVVKDLTIVVVGLKEGMKYKFRVAA
RNSVGVSLAREAEGVFEVKEQLMAPKIIMPEIVTVRAGSKMVIEGIVAGKPAPFCKWKQG
NEDVLTSDRLSVVKTLTTCTLIIKNVNRKDSGYYSLSAENSTGKVNQILRCIVQDIPGPP
SGPLEISELDIDACTLLWNSPEEDGGSNITNYIVEKCDISQGDWITVSVSCTKTSFRMTK
LTTGKEYWFRVRAENKSGISEPLYSEKMIARYPFDPPSEPRNLQINKINKDFVILSWERP
SSDGGSPITGFCIEKKERNSLLWVKANESVVKATQYTCTGLIEGLEYTFRVSAYNMAGQG
KPCKQTDFITARTAIDPPGKPEAMDVTKNSVSLVWSRPKHDGGSKLIGYHVEYTKVPEDK
WTCCNANCMNIRTESYVVQGLEEGQRYQFRVIAKTAINVSLPSEVSDPIAVIAENVPPRV
ELGVNMKSLIVVKAGDNVFLDAEVHGKPLPKVSWKKDGAPLVITEGMKATQKKHVHLLEL
YSVTRKETGDYTVLAENLSGSKYATIKVKVLDKPGPPASIKIAKVFADRVKIRWEPPLAD
GGSEITNYIIEKRETSRANWALVTANIHGHITDCSVEKLIEGHEYQFRVSAENQYGVGDA
TMTDAVTVKNPYDVPGPCEPPVITNITKDSMTVSWKAPANDGKAPILGYLVEKREATELA
WAKVNRRPVIDRTIKAVQLTEGSEYEFRVIALNKAGLGKPSDPSNAALAVDPVYPPGPPA
FPKVVDSTKHSISLSWTKPAYDGGCEIIGYLVECKQADAEEWTKCNVPKKLQATKFVVTS
LMENTEYQFRVIAVNKIGYSDPSEVPGNHMAKDILIAPEGELDADLRKALVLRAGITMRL
YVPLRGRPAPKVTWTKVDANLKERQGLLIKTSDWDTLLMIEDINRYDAGKYVLSLENSSG
SKSYTIIVKVLDSPGPPANLTVKETSRTHAWISWEPPLIDGGSPVKSYVVEKRLAERKAW
TCVSAECHKTSFRITNLEPGQAYCFRVLAENAYGIGEGCETAGSVRASEQPGPVTDFRAQ
KTTKDSITLSWKKPISDGGSYITSYILEQSEGEEKWKEIMKGKNTSHTISELADGKEYLF
RAKALNESGEGPPTELTAVAKDQFVLPDCNLSSLHDGCCVVKEGTTMRINIPVIGVPHPT
ATWKKGDMGLGDTGRICVEASQGITTLLVRDCQRGDADTYTINVRNSAGSKDCKFQLKVV
GKPGLCTGPIKFDEITADGITLEWAPPKDDGGAEVSNYIVEKRRTTDNKWATVASAIQKT
TMRVIRLHDGIEYIFRVCAENKYGIGEFLRSNPVIAQHPFNVPEAPAPPEILSIRHESAI
LTWADPKDSGGSPITGYHLEFKERNSLMWKRASKTPLRVKECRVTGLVEGLEYEFRVMAM
NVAGLGKASKVTEAVVALDPIDPPGKPDVINVTRNTVTLIWTTPKYDGGYKLTGYMVEKL
EAGGKAWMKANHVNIQSCAFTVTDLTEGAQYQFRIRAKNAAGAVSVPSETTESLTCKDEY
EPPSITLDQEMKEVVSVKAGDTIVISAAKIVGKPPPTAFWSKGGREFKNSDIVTVTSTPT
SSTLSIKYASRKNTGEYTINASNPFGIKEEHIKVKVLDVPGPPGPIEVSNISAEKCTLTW
LPPEEDGGSSIKSYILEKRETSRLQWTKVAENIMDCRHVASKLIKGNEYIFRACAINQYG
TGDSSLSGPVKMADSFGPPGPPSAPEVDNVSRNAVTISWKRPVQDGGSDIRGYCVERKEK
RGMRWVRACKRTVPDLRFKVQGLSEGVEYEFRVTAENKAGFGPPSEPSRPVMTKDIVYPP
GPPSNPRITETTKTTAAFAWGRPHYDGGLEVEGYIVEYKKEGHDDWETETQYPVKVTEYV
IGKLQKGGKYHFRVSAVNSEGVGEPAEVEKVTELVYQETIPDFELDAELRKTLVVRCRAS
IRLFVPIKGRPVPEVTWSKENTNLKARAHIDTTESYTLLVIPDCTRYDAGKYHLSLENVA
GKKSGFVNVKVLDTPGPPVNLKPREITKNSITLQWEIPIIDGGSKIHNYIIEKRDATKKA
YTVLSTTWQKCSFKFQDLEEGAYYYFRVSAENDLGVGEPAETPEPIRVSQAPSAPDNLYV
TDLTNDSASLAWTKPLHDGGSLITGYVIEAQKKDTDQWVHITTIKALDYTVTDLIEGAEY
IFRIMAVNASGRSDPRESRPAVIKEQTSAPSFDLRGVYQKTVIAKAGDRVKVEIPVLGKP
RPVVSWKKGDMALKETQRINTETTATSTILNISEIKRTDEGQYSMTGKNILGTLTETITV
LVHDIPGPPTGPVKLEEVSCDYVIMSWEPPENDGGVPINNYIVEMRETTGTSWVELAATV
IRTTFKAARLNTGTQYQFRIKAQNRYGVGPCVLSEPVFAAYPFDVPGQPGIPVVTAFNKD
SMTLSWNEPSSDGGSPILGYHVDRKEKNSILWQRISKALVIGNIFKSSGLVDGIAYEHRV
IAENMAGLSKPSKPCEATYALDPVDSPGRPVALNITRHEVTLSWTKPEGDGGFSITGYTV
ERKEMPNGRWLKANFNNILETMFTVSGLTEEATYEFRVLARNSAGAVSAPSQPSEAITCR
DDIEEPRLDIDASYSSNVVVMAGEPFKLEASVTGRPIPSLVWTKEGKELEDTAKIEIKTS
DFHTTLIGKDSLRRDGGAFTLTASNPGGFAKFTFNVKVLDRPGPPDSLSVTDVAAEKCVL
NWLHPTHDGGAKIEYFIIQRRETSRLAWTNVATDLQANRFKVTKLLKGNEYIFRVMAVNK
YGIGEPLESEPVTCVNPYGPSDPPTQPEVTTITKDSMVVCWERPEHDGGSRINTYIIERR
DKTGLRWVKCNKRTVTDLRFKVSGLTQGHEYEFRVFAENNAGLSKPSSSSPFYKAVDTIF
QPGPPGNPRVLDTSKSSITIAWNKPVYDGGSEITGYIVETCLPEEDEWTIHTPKKGWTAT
SFTITSLKENQEYKINICATNSEGVGEPAAVPGTPKAEDRLISPEIELGAELRKVVSIRA
CSTLRLFVPIKGRPAPEVKWSREHGESLDKANIDITPSFTTLQIDNVDRFDGGKYLVTVE
NASGSKTAFVNVRVLDTPGPPQNLIVKEVTRDSVSLVWDAPLIDGGSRVRSYIVEKREST
RKAYSTVCASCHKSSWKVGDLEEGKLYFFRIVAENEFGIGLPVETIEPIKASEKPLPPGK
VSLLEVTGRSVTLTWEKPDHDGGSRITGYNVEMQCKGSEKWTQVMVVKTNEAQVTGLTYG
EEYTFRISAFNEKGVSDARPLNVPVVAKDLVIPPAFKLIFSTFSVLAGDDLKIDVPYVAC
PKATATWLKDDVILKETTRVNAEATDKNLLLIIKEACRDDVGKYTIKLNNTAGEATTDIS
VVVLDKPGPPTGPIKLDDVTADSVVLSWDPPQYDGGCSINNYIVEKRDTSTTNWQIVSAT
VARTTIKAARLKTGSEYQFRIAAENRYGKSSFLISDSIVAQYPFEVPSSPRSVVVKSATK
ETMTVVWENPSNDGGSKILGYHLELKERNSILWVKQNKQIIPETRFKVVGLEEGIEYEFR
VYAENIVGLSKPSKVSEIQVARDPCDRPGKPEAVIVTRSQVTLRWTKPEFDGGIKITGYV
VEKKEASGRWMKASFANIIETEFVVTGLTEDQTYNFRVIAKNAAGVFSQPSDSSGSITAK
DEIDPPKIDLEAKYSQVVVVNAGETFKLEAAIYGKPVPTVHWLKEGTEITEAARLEIHNT
DFSACLIVKEVIRVDGGQYTLLVKNVGGEKVININVKVLDRPGPPEGPISIYGVTSEKCS
ISWKPPLQDGGSDISHYIVERRETSRLVWTVVEQKVQTLNLKITKLLPGNEYIFRVIPVN
KYGIGEPLESESMIAKNPFVAPSPPTDVDVSSITKDSMVVTWERPNNDGGNSIQGYVIEK
RDKDGVRWTRCNKRSVTELRFRVTGLIENHSYEFRVAAENAAGIGTPSTPTVYYKALDPV
FKPGPPNNPKVVDTSRSTVSLTWGKPIYDGGSEIKAYIVEANDVAADEWFMCTPPTGITD
TKFTVKKLLEKHEYQFRVCGINKIGVGEHADVPGKILLEEKLEAPDLELDADMRKMINIR
SACTLRLFVPVKGRPAPELKWGKVEGEIKETAQIDNTGSYASLTIENVDRFDSGKYTLTA
ENASGVKSVFISVRVLDSPSPPTNLTVKEITKNSVTLSWEPPLLDGGSKIKHYIVEKRES
TRKVYTTITTCNKMSWKVEPLPEGGIFFFRVLAENEYGVGLQAKTMEPIKISEKPQPPGK
VSVLDVTHSTVTLRWEKSEHDGGSRISYYEIEMAPKDSEAWTVCASVKGLETVVSNLLKG
EEYQFRVVAVNEKGKSDPRQLAQSVVAKDLIIEPSVRPKSSSYSVQVGNDLKIEVPVAGH
PKPTISWTKDGVALKQTTRVNVSDSAHHTTLTIKDATREDGGMYTVTIANALCSKDATIE
VITLDKPGPPTGPIKIDDVSAESATLNWEPPSYTGGCPISNYVVEKRDTTTTNWVVVSAT
VARTTLKVANLKTGGEYQFRIFAENRYGKSYAIDSVPVVAQYPFQEPGPPGTPFVSSYTK
DYMVVEWHKPPSDGGSAILGYHLERKEKNSILWTKINKMLIQDCKFKSTPLEEGIEYEYR
VYAENIVGIGKCSKVSEVYVARDPCDPPGRPEAVIVTRHSVMLRWTPPQYDGGSIVTGYL
MEKRDLPEGKWMKASFTNIIENEFTVTGLTEDSKYDFRVIARNAAGAVSKPSESTGSITA
KDEVEPPKCETDPIYNQTIVLNAGETFSLEASVEGKPIPTAQWFKGSVEVENSARAEIKN
TDFKALLVVKDSIRVDGGQYTLVLTNVAGTKTVPFTVKVLDRPGPSEGPLTVSNVTEEKC
SLSWLPPRHDGGASISHYIIQKRETSRLAWTVVSSDCGATMFKVTKLLKGNEYIFRVLAV
NKYGVGEPLESEPVIMRNPFVPPGSPCELEITNITRDSMTVCWNRPQSTGGSDIAGYIIE
KRDRAGVRWTKCNKRRVTDLRFRVTGLTEDHDYEFRVSAENAAGVGQPSPPTPYLKACDP
TFEPGIPTNAHVVDTTKDSISLAWHRPIYDGGCEIQGYAVEITKAEEEEWTICTPPTGVN
LTKFTIKNLIEHQEYKVRVCAMNKIGVGEPTEILGVVIPVDKIDPPEMILDSELRKGIVV
RAGGSMRICVPFKGRPTPDVSWAKEDGELPSKAQIETAEHFTQLSIDICDKYDAGKYILN
VANSAGSKSAFVSVKVLDTPGAPLNLKVKDIKRESVTLTWEPPVIDGGSRIKNYLVEKRE
STRKVYSNVDNKCTKTSYRITGLTEGTIYYFRVLAENEFGVGQPVETKESVKTSEPPLSV
GKVNLTEVTKTTASLSWEKPVHDGGSRIIGYYIEMQPMGSEEWVVAATTKTCEGTVTGLS
AGHEYLFRVSAFNEKGKSDPRPLAAAVTAKDVTVEPGFKMRFNTYSLQQGEDLKIEIPVL
GRPVPKVEWKKEGQLLKETTRINVSSTPSSTKLVIKDASKEDAGKYTITATSSIGTATEE
ITVIILDKPGPPTGPVKIDEVSSNFVTLSWEPPEYTGGCQINNYIVEKRDTTTTVWQIVS
ATIARTTIKVSNLKTGTEYQFRVSAENRYGKSSAIVSPAVVAKYPFSEPSAPGIPVITSA
TKENMVVEWKPPTNNGGSPILGYHLERKEKNSLLWAKLNKLLIPDARFKTTELEEGIEYE
FRVYAENIAGLSPASKVSESTVARDPCDPPGTPEAIEITRNHITLQWTRPQYDGGSAITG
YLIERRKHPDKRWMKASFTNIIDTQYTLTGLTEDRVYEFRIIARNAAGISSCPSESTGEI
TAKDEIEAPDATMDSKFKDLTVVHADETFIIDADYTGKPLPEVTWLKDGKEIDKATARME
IKTTLTRTILTVKDCIRVDGGHFVLKLVNVGGVKMIPVNVKVLDRPGPPDGPLEVKGVTA
EKCYLHWSHPSHDGGASISHYIIEKRETSRLSWTMVEPNIQAISYKITKLLPGNEYIFRV
TAVNKYGVGEPLESEPVVARNPFTTPSAPSTPEESAITRDSIVLTWERPENNGGAEIEGY
VLEKRDKDGVRWTKCNKKRLTDLRFRCGGLTEGHSYEFRVSAENAAGVGKPSTPTQYIKA
CDATYPPGPPNNPKVTDHSSTTVSLSWSRPIYDGGAHITGYVVEMKEALDDEWIVCTPHT
GVQDTHYTVKKLKENAEYNFRICAMNCEGVGDHVDLPGSVIAAEKLQAPEIELDADLRKM
VNVRATATLRLFVTIRGKPEPEVKWSKADGTLNERAQIEVTSSYTMLVIENVDRFDTGKY
VLTLENLSGSKSAFINVRVLDSPSAPTNLQVKDVKRHSVSLSWEPPLIDGGAKISHYIVE
KREQKRMAFTSVSTNCVRNSYIISDLQEGVRYFFRVLAVNELGVGLSATTDQVKVSEAPL
PPGKITVVDVTRHTVTLSWEKPDHDGGSKITSYIVEMQPKGDEKWTVCSDAKALEATIEG
LITGEEYSFRVTAVNDKGRSDTKPLAMPVLVKDITMEPTINLLFHTYTVKAGDDLKIDVP
LKGRPQPEVSWKKDGSALKQTTRVNVLNSKTSSKITIKDATKDDVGKYEITLTNSIGTKT
AEISVIILDKPGSPSNIRADEVSADFISLSWDAPTYDGGCQINNYVVEKRDTTSTTWQIV
SATVARTSIKVSRLTQGTEYQFRIAAENRYGKSPAIDSAPVVAQYPFEPPGPPTNLHVAH
ATKTGMLVVWGRPANDGGSPVIGYHVESKDQSSILWTKVSRGLLTENQFKMTGIEEGLSY
QFRVYAENIAGIGPCTKSCEPVAARDPCESPHNLKVTNITRNSVSLFWDPPEYDGGVKIV
GYIVECKELPNGRWLKCNFTNLQETYFDVTGLTEDAQYDFHVIAKNSAEMLSAPSECTGP
VTIKDDVEPPTIILEDKFRQLVVIKAGEIIRIDAEITGRPIPVVSWSKDGKDIEAKARCE
ITSTNFTTTLIVRDAIRRDSGQYVLTLHNVAGTRSVAINCKVLDRPGPASGPLAVSGLTA
EKCTITWGPPQENGGAEIMHYIVEKRETSRLAWTLVYGDMKATTCKVTKLLKGNEYIFRV
RGVNKYGDGEALESEAAKALDPFTVAAAPTNVQVTSVTSEAMTICWERPVSDGGSSIYGY
VIEKREKTGLRWCRVNKKPVYDLRVKASNLREGSEYEYRVFAENAAGLSAPSTPCPLTKA
EDPQFLPSPPAKPRIIDSTKTTVTLAWNKPLFDGGAPVTGYRVEYRKSLDDEWFVGVQNT
KNTEFTVVGLTPGAEYVFVVRSINKIGASEPSPESDKQTAKEKEEEPVFEISNEMRKTLI
VKDGSSFTMTVPFRGKPIPTVSWTKPDIDLRVRAVIDTTDTFTSITLEKATRNDSGKYTV
TLSSIAGTSSLTLNVRVLDSPGPPAYVEVKEVTKASATVTWDTPENEGGGPVKNYLVDFR
EASKKGWTRLTDTCHRLTYKVSNLKEGEVYYFRVTGENDYGVGVPAETKEGTKITEKPSP
PPKLGVTDVTRESVSLAWAKPEHDGGSRITGYLVEALEKGQEKWVKCGVTKFIHFTVSGL
REKAEYYFRVKAENLAGYSDVKEMFTPVMVKDQLESPEINMKDFPHNTVYVRAGSTLKCE
IPLTGRPLPKVTLSKDNVVLKSTMRFNSEVTPDSIKIILRESIAGDSGRYDITASNSSGT
TKSFVNIVVLDRPSVPLGPVELFDVTEESASLRWLPPAYDGGSPITNYIIQKRETTTANW
IDVSSAVARCTIKVMKLTTGLEYQFRIRAENKYGISEHIDSPAVTVSLPYTIPDAPSTPE
VTAVTRESIALAWKEPKSDGGSHVFGYHLQMKDRNSIMWQLVNKTVIRSTHYKVTTVNAG
LIYEFKVAAENAAGLSVFSKASDAVLAIDACEPPINLRISDITKNSISLAWEKPNYDGGS
PITGYIVEKRKGVSPKWSKANLTNITDTHFTVAGLTQNETYEFRVMAKNAVGSVSNPSMT
VGPATCVDTYGAPEIEIPQEYLNEVKYSAGSDVELKFNITAKPTPTIEWFKDGRELKPTA
QLTFKHTFESTGIFLRDTTRLNSGTYEVKVKNSLGSSCAIVRLLIQDKPGPPAGEIQFKK
VMADNITIMWSPPADEGGAMVTHYIVEKRETSRVMWSIVSEKLVDCIVNVPRLIQGNEYI
FRVRGVNKYGIGDPLESQPIIAKNPFVPPSEPSKPKVTMITKSTMTVIWERPALDGGSDI
DGYYLEKREKKSLQWFKVVKGTIRDTRQKVSNLTENNEYQFRVCAVNKAGAGNYSEASDL
YRAYDPIDLPGEPTKLRVVDSTKTSITLGWEKPVYDGGSEITHYLLEQMNAGEKEWVITN
PQVKGCEYVVSHLKPATYYFFRVSAVNSKGKGEDIKMYQPVQAKDILEEADLDLDVPMTT
QYTAKAGRDVEVFIPLKGRPAPNVTWRRGDRNMAGDNRFTIKSTERSTTLLIPKVTRDDC
GKYMLEIENGVGEPKIITVSLRVLDSPSSCQKLIIKNVTRGKLTLSWEAPLVDGGSPVTN
YIVEKKASTMKAYQVISAECPNTSYKVTDLEEDIAYFFRVSAENEFGVGDFCESTEAVRA
TETPGAVKNLVMLDSTKTSVTLQWTRPDHDGGSHITEYIVEKRSQDEVNWSLGATCKRCT
CEVTGLRENAIMDFKVFAKNEKGRSDFSLIGSIPVIDFIIPPEASLSDYPNGELAVRIGQ
NIHIELPFKGKPRPAISWLKDNLPLKESEKIRFRTTDNKTAVTVRGAKKENAGQYTLVLD
NRVVKNYFDINVITLGPPTAPVGPIRFDEIKAQSIIISWDVPKEDGGGEITCYSVEKRET
SQANWKMVCSSVVRTSFKIPNLVKGAQYQFRVRAENKYGVSEPLCSSHVIAQHQYKPPGP
PGKPVAFNVTSDGMTIKWDAPGFDGGSPIVGYHVEKKDRNSLLWQKVNSTIISNKEYRII
GLMEGLEYSFRVYAENNAGLSPVSEQSKHALAISPVDPPGTPVCIDTTRDSVTLQWEVPK
RDGGSKIVAYNVERRQGRGKWLRCNFIDISDTQFTVTGLSPGDRFEFRVIARNAIGTVSP
PSNSSGYIMTKDESITPEIEWSPDQVLTLKAGENVKLNCTITGRPVPQVLWYKDGKEIDK
RTMIDIEITTGIGTSSLFIRDADRNHRGIYTVEAKNSSGSRKADVNVRVQDTPGPVEGPI
RFTGITAEKCTVWWNPPENDGCAAITHYVVEKRETSRISWALVTSKCEACSYNVTNLIKG
NEYQFRISAVNKFGVGKPLDSDAVIARMQYTVPDAPGTPDATHITGDSITMCWTRPRSDG
GNEIKHYILERREKKSLRWVRVSSKRPITELRHRITHLTEGNEYEFRVMAENGAGIGPAS
STSRLFKCREPTSAPSAPSVIKVIDSTKSTVTLEWTKPVFDGGLEIIGYNIDMCKASLEE
WHRVNSQICIHNRYTAKGLVAGELYKFRVSAVNGSGEGEASVMPHPVQALDRLTSPEFDI
DANFKQTHTVKNGGIVTLSVAFRGKPTPLATWSRVDGEVPVMADINTTDSSSTLTIEGCT
RYEAGKYTLSLENNSGRKSITFTIKVLDTPGPPGAISFKDVTRGALTMMWDAPSNDGGAR
IHHYIVDKREASRLAWQEVSSKSSRQMIRITGLDIGVPYLFRVTAVNQYGQGEPKEMTEP
VVATEEPAPPKRLDVVDTTSSTASLVWLKPDHDGGSRIRGYIVEFRAKGSDRWIVYGETK
LPKMLVEGLIENTEYDFRVKAKNDAGISEPQGTFTSVIIKEPLIEPTADLSSITNQLITC
KLSNTITIDIPISGRPAPKVTWKLEEMKLKETDRVLIRTTNERTTLIVRDSKRSDSGKYY
LILENAAGVMTFTVTVVVVGRPSPPTGPVKISGISSESCTLSWSEPADDGGTEVTNYIVE
KRESGHASWQVVNSSVQRTTIKVTHLTKYMEYTFRVCAENKFGVSKSIESAAVVIEHPFI
PPSPPTRPDVVFVSANAIGIKWDVPYSDGGSQVTGYWIEKKERNTILWVRENKLPCLECH
YKVSNLIEGLEYQFRVYAMNLAGLSKASEASRPVVALNPVDPPGKPEITDISRSSVSLCW
TVPFNDGGNKIVGYIVERKVYSTDEWDDNRWLKCNYTTITENYFTVTNLGEGETFEYRVI
AKNAAGVHSMPSVTTGPITCKDEYSPPRAELDSKLTREVITIMAGSDLVLDGAVGGKPEP
TVYWSKGDKILDLGEKYSLTYTSTRAMAVIKNCDRYDTGRYILTVKNANGIKTASVSVKV
LDTPGQPADKIVISRVTEEKCTVSWKIPLEDGGDIVTHYIVERRETSRLNWVIMETECKS
LSCVSSRLIKNNEYVFRVRGVNKFGPGVPLESEPVIARNAYTVPSPPGAPEATAVGKEHI
IIEWLKPESDGGSEIKNYIVEKREKSSTRWTRVNRTYTIYDIRLKITGLIEGGEYQFRVT
AVNNAGESQPSDASPYIICKDPTYTPAAPSTPRIVDTTKHSISLTWTRPMYDGGSDVTGY
VIEILEEDSEQWYRATAKPIKTNEYVAGGLAANKKYRFRVAAINGNGTGEFSDPSGEIEP
LEKIEMPDLELAEDLKKTVCLRAGGTLRLFVSITGRPAPVVAWRKTGVELQSRGFIETTD
SHTSLLVEKVTRYDSGKYVVEAENPSGKKTCIILVKVYDTPGPPGSVRVKDYTKESVVIT
WDVPSLDGGAHVSNYIVEKREANMKSYKTVTTECRKTLYRITGLEEGMHYFFRVLPENIY
GVGEPCETAESVLVCEVPSVPMDLSIVDVTKSTVTLHWERPHHDGGSRLTGYIIEACKVG
SDRWSAVATVKASQSQHTIQSLTENDQYLFRIRATNSRGVSEPMDIVTPVIIQDIKVMPK
IDLTSIPQKIVHVHRGKSIDLNIPIKAKPLPVCSWYFGGAKLKDSLDRIKIDSNGKYTHL
VIRDSTIDDTGDYTLEVKNAIGMATEVIKVIILDKPGIPVGPMKIEEVDGVSVTVSWEPP
EKDGGANVSGYVVEQREAHHPGWSTISESVTRPCFKFTRLNEGTEYVFRVAAMNRFGFGG
FLQSEVVECKSAKTIPGPPSRPEVIDVTHEGMTVTWQPPVDNGGSTIAGYIIERKEARSD
RWLRINKNPVTMTRYRSSGLIEGLEYEFRITAINSRGTGKPSESSAVAVAMDPIEPPGPP
VKPRVTDSTRTSVSLAWLPPEEEGGSVVTGYLIEMQKVDQVEWTLCNTTPTKMCEYTLTH
MPQGAEYRFRVIACNAGGAGEPAEISGVVKVQEMIDYPDFELDRVYEEGYVVRQGGVVHL
SVPIKGKPIPTAKWTKDGRDISHRAMIATHDDITELVIKEAHRDDTGTYDLVLENKCGRK
AVYIKVKVIGRPDAPEGPLEFDDIQARSVRVSWRPPSDDGGSDILGYIVERREVPKAAWY
TVDARVTETSLVVKGLKENVEYHFRVFAENQFGVSRSLKSDGTVLPKTPLCPPEPPSNPP
EIMDITKTAVSLSWARPRDDGGSRVTGYYVERREVSTEKWVRHNKTHITTTMFNVTGLIP
NAEYMFRVVAQNDIGQSEPGPASESVVCKDPFDKPTQPGDIDIISITKDSITIHWLRPEH
DGGKEILGYWIEFREAGESAWKKCNKERSKDRQFTMGGLMEATEYEFRIFAENEAGLSRP
RRTPMGIKTKLSVGEAPALKEEAQDVTTKLGESGTLTCGIIGRPLPEIKWYRYGKELIQS
RKYKMSSDGRNHSLTILTEEQEDEGVYTCRAVNEAGEIETSGKLRLQAAPQFHPGFPLKE
KYYAGAGTSLRLHVVYIGRPIPQIMWFYGKKPLNSSENVIIENTESYTHLVVRNAQRKTN
AGRYKVQLSNVFGTVDTSLRVEIQDKPCIPEGPVVVESLLRNSVVISWKVPKDDGGSVIT
NYIVEKHEAKEGEQWHLVSSSVPGTTCRVPNLTEGSGYYFRVSAQNQYGVSEPLEIPSVV
IIKSPYDKPGIPQQPFIISSTKDSCVVCWKPPTSDGGAKITSYFLEKREKKQNKWMSVTT
KTFTETSYEVTGLIESFEYEFRVKCQNIGGESDWSEISLPVIPKSEQAPRAPAFREEIRD
MTVKYHSNATFVTKVVAHPKPVVKWYRSGKEILADGTKIKVLEFKGGYYQLVITAADEND
ASVYQVRATNPSGSISTTANLEVEVPAKIHLPKELQGMGAVQAVRGDHVTIKIPITGKPE
PAVTWQKGPEVLSSSAYHQVITTRSFTSLVFLKGVQRKDTGYYAITAKNRFGSDKQTIEV
NVADIPDAPKGLVVSDIARDSITLTWEPPASDGGSEIINYIVEKCPTTADRWIRAGHTTD
CSITIINIFGKTKYQFRVIAENQFGLSLPSPPTEPITTKEDKSVIRNYDEEVDEDREITK
EEAVFYKVKELSSKYIISEELARSQFGVVHRCVEIATKKTFMAKFIKVKGTDRELVLREI
EALNVARHKNIIYLHEYFESMEEIILIFEFISGVDIFERLGTSNFELSEQEIVRYLRQVC
SAVKFLHSQNFGHFDIRPDNIVYATRRSLNIKMIEMGQSRLLVPGENIRMLFSAPEYYAP
EVHRHDLVTTATDMWSIGVLAYVLLSGLNPFAAESMTKMIENISNCEYVFDREAFKDISL
EAMDFIDRLLVKDRKLRMTSHEALEHPWLKMKIEHVSNKVIRTLRHRRYYQSLVKKTDTI
VSAARVAFGGAFRNQRGLEVGKVKIGTEYHGLRAGPVMHASAEEGGHVRFTCSIVNFDKS
TQVSWYLGNRQLHPSPKYEISYSNGFASIYVKDIEESDDGVYRCKVVSDDGEDSAYGELF
VETLRSIREHYMSRTIRKLRRRVDKTKLLQRPPEFTLPLYNRTAYIGEDVRFGVTITVHP
EPHVTWLKNGEQIKEDDSKYTFTSDKGLYQLMIHNLDIGDDAEYTVMAHNRFGEDSCKAR
LTVIPHPVLEDTMKPMFKRLLANVECTEGDSVRFELRVSGVPTPSLKWEKDGLPLQFGPK
VVVIEQDIDYHVLHIRETLLEDDGVYKVTATNSAGCASCQATLKVDRLTYTRREYKSEEE
KLRHVQKQIEKTNKMAQHIAATEELVPLNPTAQEALKFAAEVYKPAVSTKNIEGEFDITE
EKTETKKLEEERRIFMPYEIPEPVVHDPKALDEDKAIKQFIPLSDMKWYRKIRDQYEVSE
RTERIVQKRQRRIRLSRWEQFYVMPLPRITDQYRPRWRIPKLTMDDLETVRPARRSPSPE
SEVSFRSRRRSLGDLSDEELLMPVDDYLTRKRAEEETMMLEDELELGFSASPPGSPIRVQ
RRVVEHEERRQGVRHEAAEVVETKKKRTISQYTRRRRSLSPTYIELMRPVSELIRPPHAR
PVETEGEIVGRRSPTPERTRPRSPSPIRSVERSSRSSSRFERSARFDIMSRYEARKAALK
SERKYQVVSQAPFSLDHAPRVTVRMRSHRIPTGQDTKFTLNIQAKPDAEVAWFHNGAEIS
EHGEKYIFTNMSGVLTITILDCQEEDSGTYRCVCSNSKGEASDYATLEVSGGGYTTFSSR
RKDEEAPKALVPEVTRIDHYHTTHFKSGYTSQTYLEVEESKSKLTETREVVTRERIGTSA
ERFSSGERFSSAERYDSSIKYASTEYLSSSSSYSSEKFSLTGKHATSEDKLKTSSTASAL
EQLSLPKEKSSLPAKILTKPQSVTVAEGETARFSCDIDGEPAPTVTWIHDSKTIVSSLRI
HVTTTQYKSSLEISSVTISDEGSYTVVVENSAGRQEAHFTLTIRRPPPKEETKAVKTTEP
PVKSPAPSVKSPEPSAASPAPSSAPSIKSPEPSVKSPAVASPAPEVKSPTPSVKSPEPEE
AKSVKSIKSPEPSAPSPARSLKSPTPGVKSPEPEGIKSPRGLKSPEPRLKSPPPVKTPGG
VKSPEPEEAKSPRGVKSPEPAGIKTPRGLKSPEPAGIKTPRGIKSPEPPGIKSPRGLKSP
EPEGIKSPPRVKSPPPIMSPKRVVSPPTVKSPTPKPPKVLSQLTAEACEGSVNLSCVCES
SVREVVWYVSGRRLSQSSRFEMHYSEGSCNLLIHELAESDQGEYTCEMISDGGVSKSSFS
FSGQVFQSIYKKVTAYREQQVALKGSMMVSHQESSKASSMMTKKEIHTMEESSAFSSSAH
QTMMSSMMESSSFSSMAAEMKFETMSMSSMSSMTSETYAMSSSSLTEMTSHMEGTSMRAI
GSAPRIEALPEDISIEPGKVLTVACAFSGDTKHIEWSRSGKTIDLSTGGRFHIETTEDLT
TLIITGVKEEDAGAYTLRLSNELGSDSATVHISIRSV
NT seq 82734 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacacaagcgccaacgtttactcagccgctgcagagcgtcgtggcactggagggt
agtgccgcttcgttcgaggctcaagttagtggttttccagttcctgaggtgagctggttc
cgtgatggccaggttctttccgccgcagctctgcccggcgtccagatctcgttcagcgac
ggccgcgctgttctgagcatccccgctgtgaccgccgcacacagcggacgcttttctgtc
agagccaccaacggcgctggacaagccacgagcaccgccgagctcctggttacagccgag
acggcaccaccgacctttattcagagactccagagctccacggtgaggcagggcagccag
gtgaggctgagcgtcagagtctcgggcatccccacacctgtggtgaagttctacagggag
ggagccgagatccagagctccgccgacttccagatcctgcaggacggagacctgtacagt
ctgctgatcgctgaggccttcccagaggattctggggcgtattctgtaacaaccaccaac
agcagcgggcgggccacatccacctgcgagctgctggttcaaggtgaagaagcagttccc
attaagaaaacaaagacgatcatgtccacatcccagatggagatgtctggaactacagtg
gagaggaaatccatggaggccagtttccaggccaccaccatgatggagatgcacgttgaa
ggaggaatcatgactcaacacattgctcacaaaaccccaccgagggtcccaccgaaaccc
acttccaggtctccgccatccttcgtctccaaggtaacgggaggtcgccagcagtcacct
tcacccgtcagacacgtgaaggggccaacacccgcacctgtcagacccgtctctccctcc
agcaggatgtccatctctcccatcagacctgtccggtctcctgtgatgaccagaaaacag
gtatctggctccgctgaggtactgccgccctggaagcagggagattacatggctgaaggc
tacaccagtatgaccagcatgaccagtatgagcagcattagcagctccacacagctgcac
atggaaaaacagtgggagcatcaggtggccgccaccagagagactgaaggggagaaaaaa
gccgaggcggtcgccaccgtgttggctgccgttgaccttgctcgtgttcgccagcccatt
catgaggaaggcgtctgggctggagaggaggaggaagaagaagaggaggttctcgaggtg
aagcagaaggcagcagtgataacagacaaacaggttgttgctgcaaaaaccaaagagcaa
cgacaagtccagatccaggaggtccagcagatccatcagattcagaaaacagccgaagtc
tcctcccacgtggacaccggcgtcgctccgtccacagtcccacatttcatggtttctaaa
gtttccgttcctaaacacgaaacgagccgggaggtgtccatcaccggctcagccatcgct
gctctgcacaaagagctggcctccccgtccgccaccaggaagatcatcaaaccggtcaag
tctcctagtccatctcgcaggtcggtggtggaggccagagtgacgctggagcccctccca
ccgccgtttaaggacatcagatatcagaggcagtttgagggcggggcttatgcagtgagt
gaggaggagtttgaggactgggaacctcaggaggcggtcgctgtgccaatgagagcccaa
gaacctgcagtccctcccactatcatggcaggcctgaagaacctgacagtgacagagggc
gagtcggtgaccctggagtgtcagatcagcggtcagcccgcccccatcatcatgtggttc
agagaggactacaaaatcgagagttcaatcgacttccagatcagctatgagaatggcgtc
gcccggatgatgatccgcgaggcatttgccgaagacagcggtcgcttcacttgcacagcc
actaacgaggccggaaccatcagcacctcctgctacctgctcgttaaagtttcagaggaa
atagagagcagagaggagatggtgactgtcacagaaactgggctcacacaagccaaaacc
attgctgtcgagatgagggagcaggcagagatcagcgcaggagaatctgctgcccccttc
tttattaagaaacccactccccagaagctagtggagggaggaagtgttgtgtttgagtgt
cagattacaggaaacccaagacctcacatcatttggaagaagagcggcgttccgctcacc
actggatacagatacaaagttgcctacaaaaaggaaaccggagaatgccgactggagatc
tcaatgaccttcgctgatgatgcaggggaatactccgtctttgctaagaatcctctcgga
gaagcgtcagccactgccatcctgctggatgaagaacaatatgaagcctacatgaagcag
caagatgtgacatataaaaccgaagtgacaacaactgtggtgcaggagccccagccggtc
gtagctcagtatgagtttgaacaaaggagggtgacgacccccatgagctttgtctcagaa
acggagttcatgatttcagcctttgaggagagaatcatccaggagattgagatccgtatc
ttgaggatcacctacagagagttggtgaccgaggacggagagctgatggtgactgtcgca
gaagaagaggcgctgcaaccggcctttgagacgccagtgaaaaactaccggatcatggaa
ggaatgggcgtcactttccactgcaggatgtctggcacgccgctgcctaagattgtttgg
tacaaagacggccagcgcatcaggcccggtggccggtaccagatggaggtccttcaggat
ggacgagccagcctccgtctgtctgtggttcaaccagaggatgaaggagtgtacactgcc
ttcgcctccaacatgaagggaaatgccgtcagctcagggaagctctacgtggagccttct
ggaggtgtaacccctcccagttacacaccacagccatcaatgcagagaatcagatccaca
tctcctcgctctctgagccgctctcccggccgttcatccagccgttcacctggacgttcc
ccagctcgccgcctcgaagagactgatgaaattcacctggaaagactttacaaacccgtg
tttgtcatgaagccctcctctatcaaatgcgcagagggccaaactgccagatttgactta
aaggttgtaggaaggccaatgcctgaaacctactggttccataatggacaacaaattgtc
aacgacttcacacacaagatagtgattaaggaggacggcactcagtccctgattattgtc
ccagctgtgccaaaagactctggagaatggaccgtcgttgctcagaaccgagctggacga
acatctgttgtcgttaatctctctgttgaagccagagaaagcgtatccagacctcaattt
gttgaaaaactgaagaacatcaccgtgaagcagggcacattagtggaactggctgtcaaa
gccatcggaaaccccctgccagatattgtttggctgaaaaacagcgacatcattactcca
tcaaagcacccacacataaggattgaaggaaccaaaggagaggccaaattccagattcct
tcatctgctggctcagacagcgcctggtacaccgccacagccatcaataaggctggcaga
gacaccacccgctgcagagtcaatgtggaggtagatcactctgccccgcaagctgaaagg
aagctcattattcccaaaggaacctacaaagccaaagagattgctgctccagagctggag
cctctccacatgcgttatggtcaagagcagtgggaggaaggcgacctttatgacaaggag
aagcagcagaaaccattgtttaagaagaagctcacctccatcaggatgaagcgttttggt
ccagcccactttgagtgcaggctgactccgattggagaccccaccatggtggtggattgg
ctgcatgatggcaagcctctggctgctgccaacaggctgcgtatggtcaatgagtttggc
tactgcagcctggactatgaggttgcttatgcaagagacagtggtgtgatcacctgcaga
gcaaccaacaagtttggagtcgaccagacctcggctaccctgatcgtcaaggatgagaaa
ggccttgttgaggaatctcagcttcctgaaggcaggaagggagcatatcgaatggatgag
attgagcgtattgctcatgagggaggacctacaggagtcagccttgatgacgaatccgaa
aagacaaaacctgaaattgtcctgcttccagaaccagccagggtgctggaaggagacatt
gctcggttccgctgcagagtgaccggctaccctgctccaaaggttaattggtacctcaac
ggacaactcatccgcaagagcaagagatacagactccattacgatggtatttactacctg
gagattgttgacatcaagtcatacgactccggtgaagtcagagtggtagcagacaatcct
ttaggcacaactgaacacactgtgaagctggagatccaacagagagaggactttagagca
gtgctgcgtcgtgctccagagcccaaagctgctgaggtcccacatgaatctggcaaaatt
ggatttgacattgtcaaggtggacagacctggtgaggtcccacaggacagggaagtagtt
aagctgcgtaaggcacagagaatcgttcatgagaaaacctctgaggagtctgaggagctg
aagagcaagttcaagcgcagaacagaggagggcttttatgagtctatctctgcagtagaa
ttcaaatctcgcaagagggatgactcctatgaagacttactaaaaaagactaaagatgag
ctacttcatcacatgaaggagatggaagaagctgaaaggaggaggatggaagagcaaggc
aaaatcaccatccccacaatcaaaccagacaggatccagctgtcacccagcatggaagcc
ccacatatcctcgaacgaattggaagcaaaactgtttctccaaaggacgaggttcgtttc
agtgtcagagttgtcggtaggccagaacctgagtgccagtggttcaagaatggcattctt
ctggaaaaatctgaccgtatttactggtactggcctgaggaccatgtgtgtgaactggtg
attagagatgtcacagtagaggactctgccagcatcatggttaaggccatcaatgtcgct
ggagagtcgtcaagccatgccttccttcttgtacaagccaaggcaaccattagttttatc
caaaacctggctgatgccagtgcaaatgagaaggacaccatggtgacctttgaatgtgaa
accaacgaaccattcgttaaggtcaaatggctgaagaataatgttgagattttctcagga
gacaaatacaggatgcactctgacagaaaggtccacttcctgtctgtgcttgtcattgag
atgagtgatgatgcagaatactcatgtatggtcatagatgacgagaatatcaggactaat
gcaaggctccatgtagaaggtgccgccctggagctcaacaaacatttggaaaacattgaa
gtaccagagagctacgctggagagtttgaggttgaggtttctcgcgaagatgctgaggga
aaatggttctttggcgagaaggagctctctcccagcagtaaatacgtcatatcctcccgc
cgaggtcggcacaccctggctgtcaaggacgtcaggaaggacgaccaggggaagtacaca
tttgtttgtggagatctgagtaccagcgcctcactgaaaatgaaattgcgacccgtgact
ctaatgcagccgctgactgaccttactatctgtgagggtgacattgctcagctggaggtc
aggttctcccaggagaatgttgaaggtgcctggctgaaaaacggccaggcaatctctgcc
tcagaccgcgtccacatcgtcatcgacaaacaggttcacaaactgctagtggagaatgtc
agcagagaagacgctgcgtcctactcatttgtagttccaactcatgaaatctccacctca
ggcaaactcaatgtgcaaactatcgacattgtggtgccactgaaggacgtgtcgtccacc
gaaggcacaaaggcagtccttgagtccaagatctcagctcaggacatcagctctatcaaa
tggtaccacaacgacaagctgctgatcccaggtgaccgagtccaggctgtggcaaagggc
accaagcagcgacttgccttcaccaggacctttgcttcagacgaaggacgttacaaactg
gtggtcggcaaggtcgaaaccagctgcaacctgactgttgaacaggtccatattgtgaag
cacatggaggacaaagtgtgctcagagtcccagaacgttaccttcaatgttgaggtttca
catcctggaatcgacccactctggaccttcaggaaccagcagctcaaggctggacccaaa
tacaagatggagtccaagggaacggctcactccctgattgtgttagacaccatgaaagat
gaagagggccagtacatgttccacgctggggagaagacatccagtgctcagctcactgtc
tctggtggcgccatcacacggcctctgcaggatgtgacagtggccgagtctcagacctct
gagttcgagtgcgaagttgccaacgctgaagctgaaggcaagtggcttaaggacggtcag
ctcgtcaacttcaacgagaacgttgtgagcgaggtgaacgggtctgtcagacgtctcgtc
atcatcatcaccaggccacaggatgttggagagtacacctaccaggtggccaactccaaa
accagcgcaaacctcaaagtggaagctgtgaagatcaagaagactttgagaaaccagaca
gtaacagagactcaggaggccatgttctcactggaactcacccacccggacgtgaaagga
gcccagtggatcaggaacggagtcgaactgcagaacagcgacaagttcgagattatctca
gaaggaacaatccagactctgaaggtgaaggactgcaacacacaagatgagaccgtttat
tccttcaagctggggaaactgtccgccactgccagactcaatgtagagacaatcaagatt
gttaagaagattaaagacgtgaaatccctgctggacggcaccgcctcctttgagttgagc
ctgtcgcacgacaatgtccccgtcaggtggatgttcaaaggcgttgagctgaaggcaagc
gagaaatgcaagattctgtcggagaggaaagctcacaaactgatcctgcagaacgtcgac
agcagcaacgcaggagagtacacggccgtgatcggacacctgcactgcagcgccatgctt
actgtagaggctctttgtgtcaccaaaccaatgaagagtgtggaggtccctgagacccag
gtggccacgtttgagtgcgaagtttctcacttcaatgtgccgtccacctggctcagagac
ggcgtggagattgagatgagtgagaagttcaggatcgtggttcaggggaaacttcaccaa
ctgaagatcatgaacaccagcagggaagactctgcggagtacaccttcatctgcgggaac
gacagagtgtcagcgacgcttaccgtcaaccctgtcctgatcacctccatgctaaatgac
ctgaacgctcaggagagagacaccatcacctttgaagtcacagtaaactatgagggcatc
acctacaaatggctgaagaacggcgtagaggtcaaatcatcagaaagatgtcaagtccgc
agccggcagctcacacattcactcactatccgaaatgttcactttggagacggaggagaa
taccagtttgtagcaggctctgctgctagtgccgctaacctctttgttgaagctcgtgtg
attgagttcaccaagaagattaaagacataaagataaccgagaagaaaaaagcaatgttt
gagtgtgaagtttctgagcctaacatccaggtgatgtggatgaaggacggccaggagttg
gacttaactgaggaaaggtatgtagtgacagccgagaagtttgtccatcgtctgatgatc
cagacggttcgtatgtcagatgctggagagtattcagtcgtggccggatccagcgtctcc
aaggcccaactgatcgtagagggacgtgacgtacggatcgctgaacctgcagagcgtgaa
atcatggttcttgagaaacacagagcaaccttcgagtttgaagtcaatgaggacgacatt
gaaggacgttggctcaggaacggcgtggagatccagttctctgtggaggaaaggttcagc
tatgttgccatcaggaagctgcaccgcctcaccatctctgagacctacaggagtgatgct
ggagaatatactttcatcgccggaaagaacaggagcaccatgcacctaagagtcaacatc
ccggagcctcctcagatcctccgtcacatggagccccagtcagtcgaggcaggaaagccg
gctcgcttctccgttcaggtgagcggcgttcctccaccgcaggtctcctggtacaaaaac
tcccaggctctgtcgccgggcttcaagtgcaagttccttcacgacggcaatgagcacacg
ctgcttctgatcgaagtattccccgaggacgccgccgtctacaactgcgaggcgaagaac
gactacggcacggccaccagcaccgccacgctcaatgtggaagtgtcagaggtggtctct
ccagactctgctgcccccatcgctccacccgtcatcatctcacccatctccaacacctca
gccagagagggagaatccgcttacttccagtgcagagtccgtggagacgatgtgaagatc
agctggttccacaaggagaaggaaatcaagcagtcagacttcttcaggatgtctcagttc
gacgacagctgtcagctggaaatctccagagtttacccagaggatgagggggaatacacc
tgcgtggccacaaacaacgccgggaaagtgtcctgctctgccactctcaccctggatggg
caaattcaaacagtgagcagttctaccgagcctcagtggcacatctccagcctaaagaaa
ccgtcagttggccaaaagccggttttcatccaaccaatcacaagctgcacagtgacacat
ggggaggtggcccgttttcatgcgtgtgtatccggcctgccaaagccggaaatcagctgg
ttccacaaccggcagccggtccaaccttccaagaatgtggtgttccacttcgatgaggtg
acaaacatcgccacactcatcatagtggacgccttctctgagcatgcagggcagtacacc
tgcaaggcggtgaataacgccggggaggctgcatgctcggccagcctcaccgttatcaga
gaggaagaagtgactcttgtgagggagcagatcgaagccacagttgaagaagaagttaaa
gagcgttctagcaccaccatcaccactgtggaagaacgagaggaaaccttctacactggt
gtccagttaccacagaaatctaaaacacttgaactcaagccagaacccaaacgttactct
tccactttagagaagaaaaaagagaagccagttttcctcagccagctatccccagcagcc
gtaacctcaggggaaacagccagatttacggtcagggtgtccggctttccaaagccgatt
gttcagtggtctcgcaatggtagggtgataaaaagctcttctgcgtacaggctggtagaa
gaaaaggaggagtacacattggtgatcaccaaagttacatctgagtatgagggtgaatat
tcctgcactgccaccaacaggtttgggcagacaacatgcaccacatacctagaagtgaaa
aagcctgacatcagccaagcagagaggtgggtggagaaaatgtttaaggtcacaggtcaa
ccacctacatttactgttcagatccaacctgttagatgttcagaaggaggggaggtttat
tttaattataaaaccacaggagatccagttcctgatgtgaaatggttgaaaggggctttc
caaatccagcccagcagaaactgcatcatagtaaccaacccagatggatctggcctaatc
aatatcaagagcgtcaaacaggaagacagtggcctatacacatgtaaagcctccaaccag
tttggtgaggctacctgtagtgctgagcttgttgtgtttagggagtcggtctctgtttca
cacaaaaaggagcagctaaccatggttcagaaaaaatcctataaggtgtcagtatcagaa
caggcgacagagtctcgtctgtatcaggtcagccttccaggccaggacaagacccggtca
gatcaaatggtttataccattggtactgaagacaggaagatcattcctagtgagcaggtg
gcctcgcttggggaggctgacatctctgctgcaaccatccatcgtgagacactgacccaa
caggcagctgtgcttcagactcatgagatagaggagagggtttctgtggttcccactcac
ccgcctcaggcatcagctgttcctgggaagcagcttcacatggcagcatttacatcctct
gtagaagagagtcagggtctcacagagcagcactgtgaccgcattcagagtcctgaggtc
attgaactgcagctggcaagagaaaaacaatcaaaattaatgtctgccatggcagaggag
ctcatcccactttcaactgtcagcacagagcttctacatgacaagcagcctgctaacatc
aaacccacctctgaacccaaacacttggtcagcgggcatcaggtggagtctcaactttct
attgtaagagagcaatctgaggatatccctggacaacagcaagagaagagctacagggtg
aaggaaggtattaaaattttatattcagctcagtctacagagaaacaagtaatggaagaa
ggccacacaactgaactatcaacagcagaatctgctgtcaaatccaccattaagaaagaa
cagagtcagcccattttagcctcaatcagtgagtccaaacaaactctttctaaggagaca
gggttctcgatccagatgcctgctgaagaagcagctcagctttctaaagacagaataatg
aaggcagctttaaatgctgaagaaaggcaaatactgcaggctgagccgactaaagaactg
ccatgtctggatagggcagtgactattcagtcacatgtagaaagtgggaaggtactgcac
ctgcaggtcatcacagaccaagacctcctttcatctgaaaagagtttcagttctgaaaaa
ccagcacctgagcaggcagataccaggaagagtcccactctgttgcacactgtaagtcag
gatcagcaaaaaactgttttttgtgaagacatatcagagtttgaaactaaagccagctcg
atagccattcaaccccaaaatgaggctcagactgtgctgcatctccagtcaataatgcct
gtagaggtgctgcctaaagagggtgttttcacagatgaaaagcctgatgaacaggtagca
acacagaagcacgaaaaatcaaggagccatgcagctgtctcagaagaaagacgagaactc
acagcagattaccattcagagctagatttatcagtgaccggggttcagtctaacattcga
actgagcccaagcctcagaaaatcctccaggtttcctaccagcccatgcagctgccaaag
gaaacccccattgctgttgatctcaagcaccagaaagctttagttcagaaagaagatcgc
tggaatgtgatgcatgtcaccagtgtagcagacagtcaggtcttagaagagggtcacaca
gaaactctgtcaggtgtggacaagtttaagtgtctaacaaccatagagcctaaaatgccc
actgaaccagtccagattgaagagaaggagatctccactgagagcagcatctctctggag
gcagcagaacaggactttgctgttcagatccaggagggtcagtccgttaggcagtcgata
gtgatggatgagaagcgagtgttaacaggggagctttctcaagagatctccaagtctgaa
tcgactaaagttatagtcagcacacaaccaaaactgtcccttatggcatcagaatctaaa
gacagcactgctctccccaaagagatgatgtttgtgattcaaatccctaaaccttccagt
ctaaatatacggcatcagctcagagaggcactgcagtctgctgttgccagtgaccagcca
gtcctactggctgatgttgttggaaagttacaggctttggaagtgcaggaggtcaaagtt
cagcgagaacccaagcgctctatgtttacatatctgatcacaacaacaggtgcccccatt
gagatcacactagcttttgaaggtgaatacccgcaaaaggctgatctcaggactgaacta
caggcagcgttccactctattgtgtaccaggaggctcatgttcttacctcagagcaacca
ggcaccatgcagctagacaaaccccagagggctcatgtttcctcagccaggtcagggcaa
atgctttctacagtggtagagtctgtgcgtgtggcagagagtacagtagatttcacagct
gcaaaatctcaggctgctgcacttaagatcgagtctgatgtcacagttgaatgcgctgca
gaaggggggcaggttgtaattcaagaatccaagacagagaaggtggaaaagtccatttca
tctaagaccaagataaccacagagactcaggtggcctttgaacagtcggttcaggtatca
agaaaagaaattaggtctgtaatggtagaaagtgaagaaaaagaagtgggaacagctttt
gtcactactgctctgcctcttgccaccatccccactgagcaaacactagatgtaagcatc
cagcagaagcacagggaagagatattcaaagaggaagtcacattatccagaccagagcag
agagaataccctgaaatagttacctccctactggacttagctactgaagaagatggtgaa
gtcacttttattacaaccattaaatttgcaacaaaagtaagctggtttttcaatggccaa
ttggtgaaatctggcaaagagttcaagtgtttcaaagaccatgacacatactcactggtt
atcaacaaagttgtcaaggagagacatcaaggagaatatgtttgtgaggctgagaatgaa
gccggcaggacaacaacatcttcaagactcactgtggtcccaagagtgccacctgttttc
aggcagaaaatcaaccctgtagagatcaacgttggaggccatgcaaagttcgactgcgag
actgaggatgcgccgaacgtgaccttcaaatggtacaaatctaacattgaaatcaaacag
agtgagaagtaccggatcatcagccgccacacagggtcttcactggagctcctgaatcct
gtgaagactgacagcggtgaatacacctgcaaggcttcaaaccagcacggctttgatagc
tgcactgcctcgctcatcgtgactgagcctgctaagattgtggataaacccgaaactttg
agcgtgacggcaggcgacatggccgccctggaggtcaaagtgtgcgggacgccggagctc
gtccccaagtggttcaaggacggcatggagctggccacatccgggaagtacaagatctcc
ttctcacagatgatctccagtctcaacgtgctttctacggagaaactggactctggcgaa
tacacgttccaggtcatgaaccaagtcggaaaagacctgagtaaaattaatctcaccgtt
ttggataagaccgttcctccatcgttcaccaggaaactgaaggactataagatgactgta
ggagaagctgcagagatggagtgcaaagtgtctggctccccaccttttactatttcatgg
taccacgatggtgaggagatacaaagcgggccgaactgtgaggtttccttcagcgacaac
agctgcaccctcagagtgccgaccctgaagatgactgactctggagtttacaagtgcaaa
gccatcaacaaggctggtttcagcgaaacttcagcaactttggctgtcaaagaacctcca
tctttcgtggtgccactgcagccgatggaggccatgcctggctccaacgtgaccttctca
ggcatggtgaagggcagcgcgcccctcaccctgaagtggttcagaggaaccaaggagatc
ctgccagggaaagactgcagcttcactctgaaggacaaccaagtgactctggagcttcac
aacgtgaaccgatcccatgctggagagtacacctgtcagatcatcaacgatgcaggaaaa
gaaagctgtgctgtgaatctcacaatcaaagaaccggcagccttctctaagaagctgaag
gacgtgtcagttgagaagggcaaacctttaacgctcgagtgttcgtacaccggaactcca
aagatcacagtgagctggttcaaagacggccagcagatctttgcttcctacaaatacaac
atcaccacgacggaaagctcctgcatcctggagtgtctcagcacagacgacaaggaggcc
gcagggacgtacagctgccaggtgtccaatgacgcaggaaaggacacaagtgaagctgtt
gtgtccattttggagcctccatactttgttgaatctctggagcccatggaggtgacagct
ggtgatgctgtgtgtctgaagtgccaggtggcagggacacctgagatcaaggtgtcctgg
ttcaaggctgacggcaaagtgcggtccagctccagctgtaagttggagtactcaaagggc
gtcgccagtctgaagctcagcaaagccaccaaagctgacattggggagtacacctgcaag
gcggagaacaagatcggctctgcctcctccacctgcagactcaatgttcttgaggccaaa
acacctccttccttccccaaaaagatcaccagcctgcaggagacagaaggtcaagcggtg
cgttttgagtgccgtgtcgccggctcatcacccattgaggtgtcatggctgaaagacggc
gagccgctgatgcagggaggcgagttctctatgctatatgacgacaacacggctgtgctg
cagatcagccgtggcgaaatgaggcactctggggagtacacatgcgtggcgaccaacagt
gttggctcaacttcctgcagagcaaaactcaccatgcaagaacccagatacgctccggtc
tttgacagaaagttgtcaccgcgggaggtgacggtgggtgacagcatcgaaatggagtgt
cacatgaccgggtctgctcccatcaaagtcacatggtccaaagaccataaagatatccgc
tctggtgggaactataagatcagctgtgtggaaaacaccgcccacctgaccatactgaag
gcggataaaggtgacacagggaaatacttctgccatgcctccaatgacatggggaaggac
tcttgttccactgacatctctgtcaaagagcgtaaaaatccaccgatgttcaccaaaaag
ccctcggagcacatcgaagacatggagggcaaactggtaaaaattgagggccgagtctct
ggttctcagcccgtttcggtcagctggttcaaagacggcaaggaaatccacagctctgac
aaatacgatatcagctttaagagcaatgtggcggtgctgtgcatcaagagcagccaggtg
accgacagcggcaggtactcctgccaggcctccaatgaagctggaagagcttcctgcgac
atcactgtgggcatcctggaagccaagaagcctccagtgtttgatgttccactcaaacca
gtgactgtggatgaaggcgacaagctgagcctcaggtgccacgtctgcgggtccgctcct
ctgaaggtccagtggatgaaggacaggaaggagctttcttcagccggcagcatcaggctc
ggcttctctgatggtacagccagtctggagatcagctcagcctccaaacatgatgctggc
gattacctctgcaaggctacaaatgaagccggcgccgagttctgcaaggccaaagtcaca
gtgaaagagaaaccaggagcagctaaacctgagactccagcagcagctccaaccaaaaaa
ctggataatctgtttttcattgaggaacccaaatccatgcacgttacagagaagggaact
gccaccttcatcgctaaagttggaggagaacccatcccaagtgtgaagtggatgaaggga
aaatggaggcaactcacccacggcggccgcatctcaatcgtgcagaagggccaggagtcc
aagttggagatccgagaggtgaccaagtcggactcgggtcagtaccggtgcgttgcctct
aacaagcacggcgagatcgagtgcaacgccgacatgcacgttgacggaaagaaagaggcg
ccgcaactagagggagacctccgagccaagctgaagaagacgccatcgaagcagaagagt
cctcaggaggagaaggacatcgacattgtcgagctgctgagaaacgtcgaccccaaagag
tacgagaaatacgcccgtatgtacggcatcactgactacagaggtctgctgcaggccatc
gagcagctcaagaaagagagaggcgaagaaagtggaagaccggaagtggaacgtggagac
agagagtcagatgaggacatggctcggttggtggccgacctgcagaagaggatggagagg
acagagcctgtcaccgtagtgaaggacatctccaaccagtctgtcttcaccaacgaagag
gcggtgtttgaatgcgagatcaagatcaactacccagagatcacgctgtcctggtacaag
ggcacgcagaagcttgacacagacgacaaatacgacatcagcatcagcggcgaccgccac
ctgctcaagatcaaaaggtgccagccgtctgaccagggcaactaccgggtggtgtgtggg
ccgcacatctccagcgccaagctcaccgtcacggaggtggaggtggagaagcacctgcag
gacacgtcgggtaaggaaggccaggcgtgcactctgtcttgtcagttgtctgttcctaac
gtcgaggctcagtggtttaaaaacggaaagcagttagagatgaagggaaggtattcgtcc
gaggtgaaacacaaagttcagaagcttctgatcaaagacctgaagtctgaagaccggggc
agatactcctgcagataccagcacctggagtcctcggcggacctcaaggtggaagccgaa
caaattcatttcaccaagcgcatccacaacgtggaagtcaacgagcgccagtcggccacc
ttcgagtgcgaggtgtccttcgacaacgcaatcgtttcttggtacaaagacacgtgggaa
ctgaaagaatgcactaagtacaacttcagaagcgagggcaggagacatttcatggtcatt
cgaaatgtgaccattgaagacgaaggcgtgtactcagtgattgtgagattggagcccaga
ggagaggctaagagcacagctgagctttatttgtctggcaaagaaatcgaattagcgatg
gtaccgacagatttcccagactcttcagttcagaggcctgaagtgccttcatcagaagaa
attcaagaatctgctgagttctatcagtatgaagaaaagatcgaacagagagaatcagct
gaatattcgtatcagtacgaagaggaggtgcagcagaaagtcgagtatcagagctggaca
gaagagactgtaacacaacagatttcagagactaaagctgccagagttgctgttgaagaa
aaagtggagaccatgaaagttgaagtgagggaggaaatcccagctaaagttgagaagaag
cccgaagagaagccgactgcagctgtggaggaacccaagaaaaaaccagaggccaggaag
ccagtagaggaaaaggttcctgcagtttcagtcccagagaagaaggaagtttctgctccc
aaagaaccagaggacgtgaagaagccagtcgctgctccaaaagagaagcccggacttcca
accaaagatgaagccaaacctcaggttccagctgagcccaagaaaccggttcctgaagca
aagcccaaagctgaaccagaagccaaacccgccccaactccaaaggcagagccagaacca
aaggctaaacctgctccagctcctaaagaagaaccagaaccaaaggctaaacctgctcca
gctcctaaagaagaaccagaaccaaaggctaaacctgctccagctcctaaagaagaacca
gaaccaaaggctaaacctggtccagctccaaaagtagaaccagaaccaaaggcaaaacct
gctacagctccaaaagtagaaccagaactaaaggctaaacctgctccagctccaaaagaa
gaaccagaaccaaaggctaaacctattccagctccaaaagtagaaccagaaccaaaggct
aaacctgctccagctccaaaagaagaaccagaaccaaaggctaaacctgctccagctcca
aaagtagaaccagaaccaaaggctaaacctgctccagctccaaaagtagaaccagaacca
aaggttaaacctgctccagctccaaaagtagaaccagaaccaaaggttaaacctgctcca
gctcctaaagcggaaccagaagggaagccagtgattcctccatccaaagatgaaaccaaa
ggaccggtccagacaccgggaggagtccagaaagaggggcagccggcagaggaagcagga
agaggcagaggcagagggctaaaacccaagcagacgccatcgcccggagagggcagaggt
cggggcatgaaacctggtgggagaggtggccccacaccaccagaggaaccttttgcaggc
ttcaaactcaaagccgttcccctgaagttcatcaagaagctggaaaatattgtcctcaag
gaggccgagtccattggctcatcggccgtgtttgagtgtgaggtttcaccctctacagcc
atcacctcctggatgaaagatggcggcaacctgcgtgagagtcccaagcacaagttcacc
tctgacggcaaagaccggaagctgcacatcattgatgtccagctgtccgacactggagaa
tatacctgcgtcgccaagaatgctggaaaggagatttcctgcactgctaagctcatagtt
gaagagcttcctgtaaaatggatcaaggaattggaaccggagaactcggccatcctgggc
cagcccatctacatatcctgcgagctgagcaaagagagggacgtggtctggaagaagaat
ggtgaagtcctcaagaaaaaggagggcaaaattcaaatcaacatcattggattgcaacac
gccgtgaccatccaaggctccacactagaagacgctggtacctacacctgtgaagtgtca
ggacaggaggacgtcgtgaccaccacaaacgtcaaagtgctcggccgggtgatctccctg
gtgaggcccctgaggaacatcacagtgactgctggagagaccgccaccttccagtgcgag
ctgtcctatgaagacatccctgttgattggtacctgggggacacgaagctggagtcaagc
gacagagttgtattcaaggatgaagggaaaacctacagcgtcacggtgagagacgtccaa
ctgagtgaagctggacaagtcaaactcatcgccaaagacttcgagacagaggccaccctg
tctgtcaaagagccgcctgtagagttcaccaaacctctgcaggaccaaacagtggaggag
aaaaccaccgccacgcttgagtgtgaagtttccagagcaaacggagaggtccaatggctc
agggacgaccaggagatccgcaagacgaagaagtacgaaatcctggccgagggctgcaag
agaacgctggtcatccaggattgcaccctggacgactccaagacctacacctgcgacgcc
aaagacttcaaaacgtcctgcttcctcacggtcgaagctgcccgtgtcgagttctccaag
cctctccatgatgttgaggttcgggagaaagaaagtgccaggtttgagtgtgaagtctcc
agagaggacgctaaaatcacctggttgaaggacggaactgaaatcagaaaaggaaagaaa
tatgaaattattgcacaaggccgccaacacatccttctcatccacaaggccacatttgat
gacgaagctgaatacgaatgtgatgctcagacctccaaatcctccggcatgctcaccgtc
gttgaggaggaaactactttcactaaaaacctgccaaacgtcgagggaacagagacggac
agcgtgaggctgatctgtgaggtctccaagcccaacgctgacgtcacctggtacaaaggc
gacaaggagctgccagacggcggccgctatgaacacatcgttgatggcaagaagaggatt
ctcctcatcaaggacctgaagacagacgacgccggagaatacagctgcaggctgagcacc
ggcaccaaaacctccggaagcctcaagatcaacgaactggctgctgaattcctgtccaga
cctcagaaccaggaggtggtggagggtcatagggcagagttcacctgcatcgtctccaag
gaaaccttcagtgtcaaatggatgaaggacggcaatgagctggagtcaggagacaagtac
gagttggtgagtgacggcaagaagcgaagtctggtcatcaaggcgtccgagctcaaagac
gagggcggatacgttgtggtgattggagagacgagagccagcgctgatctgactgtgagc
gcgaaactgaaggtcatcacccctctgagagacacggaggtcaaagaaggccaggaggtc
gtcctgaactgcgaggtgaacatcgacggagccaaggccaagtggctgaagaacgaagag
actctgttcgagagcggcaagtacgtgatggttcagagagacaacgtcttctcgctgagg
atcaaagacgctcggaagggagacgaagccgactacagcatcacactgaccaatcagaga
ggagaacaggccaagagctccggcaaactctccgtcagagaggagagtctgaaaatcatg
gttcctccggaggacatcgacactcaggagaagaagaccatcagcttctcctgcaagacc
aacagacccaacgccactgtgaagtggatgaaggccggccaggagatcaccttcagcaaa
cgcgttgtctacagggtcgacaaagaaaagcacacgctcaccatcaaggactgcacgctg
gccgacgagggcgagtacacggtggtcgccggggacaacaaggccaccgccgagctgatc
atcagcgaggcgccgaccgacttcagcgcacagctcaaagaccagaccatcaccgagttc
gatgatgcagagttcacgtgcgagctgaccaaggagaaggccgaggtcaagtggtacagg
aacggacgggagatcagagaaggaccaagatacgcatttgtgaaagacggaaagttctgc
acgctgcggatcaaggagtgcaggccggatgacgagtgtgaatacgcctgcggagtcgac
gataagagatccagagccaggctctttgttgaagagattccagtggagatcatcagacct
ccacaggacgtgtttgagcctccgggctcggacatcgtgtttgaggtggagctcaacaag
gaccgggtggaggtgaaatggctgcgcaacaacatgaccgtcgtccagggagacaagttc
cagatgatgagcgaggggaagctgcaccggctgcaggtctgcgagatccgacccagagac
cagggactgtacagagtcatcgtcaaagacaaggacgccaaggccaagctggagctggca
gctgttcctcagataaagaccaccgatcagagctacgtcacagacgccgggaagcccatc
gtcttggccgtcccgtacagcgcctaccctcaggccgaagctgactggctgtacgacaac
cagagtgtgtccaaagacaacatctacacctccgccgagcgcaccgagtaccggctgaag
gacccgaagaagtcggaccaaggacgctacaagatcgtcatcaagaacaaacacggacag
ggagaagctttcatcaacctggacgtcatcgatgttcccggacctgtgaagaaccttcag
gtggtcgacaccgcggacggcgaggtcagcctggcgtgggaggagcctgagaacgacggc
ggcagcaaagtaatcagctatgtggttgagaggcgcgatgtgaagcgtaagacctggact
ctggccaccgatcactcagagagccccgagtacacagtgacggggctgcagaaggactcc
ttctacttcttcagagtcagcgccagaaacagggtcggcaacggacccttcgttgagacg
gacgaagctgtccaagcaaagaacaagtttgacgttcctgaagctcctctgaacgttgac
gttggaaacgtaaccaagtttggctgcaccgtctcctgggaccctccagtgtcagacgga
ggctctcccatcacctcctacatcgtggagctgcgcgacaggacgtcggtgaagtggtcg
cccgtccaggtgacgaaagccggcgagctcagtgccatcatcaatgacgtcatcgagaac
aaggagtacatcttcagagtcaaagctgagaacaaagctggcgagggcaaacccagcgcc
gcttcacgacctgttaagatcatggatccaattgaacgtcccagtccaccacagaacctg
acctggcaggaccagaacaagagctcagtgcagctcacctgggagacgcctctgaaaaac
ggcggcagcatcatcacaggctacatcatcgaacgctgcgaggagggaaccaacaagtgg
ctccgctgcaacgcacgcctctgcccagatctcttctacaaggtgtctggtctgaaatat
ggaaccaagtacaactacagagtgtttgctgaaaatgctgctggagtttctgaaccgtca
aacgtcatcggacctctgctggcagacgacccacattttgctccatcctttgacctgagt
gctttcaaagatggcctggaagtgatcgtccctcagcctctcaccatcagagttcccatc
accggatacccgacccccgtcgccaagtggaccttcggagagaaggagctgacgacagca
gacgaacgcgtctccttgatgaccaagtccactttcacagaacttatgatcacgccgagc
gtccggccagacaaaggcatctacaccctccacctggagaacgacgtcacctctgtgtct
ggagatatcgaagtcaacgtcatcgctgcacccagcgctcccaaggacttcaaggttcta
gaggtgacccggcagcacgtccatcttagctgggaggctccagaacacgatggaggaagt
cctctaaccggctatcaggtggaaaaacgggacgtgtcccgcaagacctgggtgaaggtt
gtatcagggatccaggatctggagttcaccgtcactgatgtggttgaagggaaagagtat
ctgttcagagtcaccgcctgcaacaagtgcggcccgggagagccagcgtacatcgatgag
cccgtcaacgtctcttctccagccactgtgccagacccaccagagaacctgaagtggaga
gacaagtcagccagtggcatcttcctcacctgggagccgccgaaatatgacggtggcacc
ggcatccgaggctacaacgtggagcgctgccagagaggcacagataagtgggagccctgc
ggagacacggtaccagagctgaagtgccaggtgaccggtctgatcgagggcgagtggtac
gcctacagagtccgagctctgaaccgactcggagccagccggccctgcaagcccacagat
gagatccaggctgttgatcctatagaggctccagagatccagcttgatgccaagcttctg
gccggtctgacggccaaggctggcagcaaaatcgaactcccagctgaggttaagggtaag
cctgaaccccgagtgaagtggaccaaggctgacctggttctgaagccagacgacagggtg
tccatcgacaccaagccgggacattccaccgtcaccgttgctaagactaagagagacgac
agctccacctacatcattgaggcgaccaacagcagcggccgtgccaccgccactgtggat
gtcaacatccttgacaaacctggtcctcctgctgccttcgacatttctgagatcaccaat
gaaacctgcctcctggcctggaacccgccacgcgacgacggcggttccagagttaccaac
tacatcgtggaacgccgagctgtcgacagcgagatctggcaccggctgtcctccaccatc
aaacagaccacgtacaaggcagtcggcctggtcaagttcaaggagtacatcttcagagcg
ttcgctgagaaccagtttggtgttggtccaccagctgaacacccgcccatcatcgccaga
tatccatttgacacccctggggctccctacaaactggagccttcagacatcgccaaagac
gccgtgaccctgaactggtacgagccggatgaggatggaggcagccccatcacaggctac
tgggtggaacgatacgaaccggaccatgacaagtggataagatgcaacaagctgcccatc
aaagacaccaactacagagtgaaaggtcttcccacgaggaagaagtacaagttcagagtc
ctggctgaaaatctggctggaactggaaaacccagcaaagagacagatcaaatccttatc
aaagaccctattgatcctccttggcctcctggtaaacccacagtgaaggatgtagccaag
acttcctgcttccttacttggaccaaacccgagcatgacggcggggccaagatcgacagc
tatgtcatcgagatgttgaagagcggaaccacagactggatccgtgtggcagagaacatc
agcatcctggagtttttcctgaagggcctgatggagaagcaggagtattcgttcagagtg
agagccatcaacgtggccggggagagtgaacccagcgagcccagcgacccggttctgtgc
aaagagaggctgaatcctccatcggctcctcgatggttggaggtcgtgagtatcagccgg
agcagcgctgacttgaagtggacggctccggagcgtgacggaggatctcgcatcaccaac
tacattgtggagaagcgcgacgccaagcgtaaaggctggcaggctgtggacaccacggtg
aaggagctgaaaaccaccgtgacgccgctcaacgacggagctctgtacgtgttcagagtc
gccgcagagaacgccgtgggtgtcggaccgttctgcgagctggaggactccgtgttggcc
aaggatactttcactactcctgggccgccctacgcactcaccgtctactctgtgaccaaa
aagtatgtggacctggagtgggaggcacctaaaaatgacggcggtagacccatactcagg
tactctattgagaagaaggagaagcttggaacgcgctgggtgaaatgtggaaagacttct
ggtccagactgtaaataccgggtaacggatgttattgagggaacagaagtccagttccag
atccgggctgagaatgaggctggagtcggacacccgtgtgaacctacagagatcttgacc
attgaagatccaacaggaatcccatctcctcccatcgagctccatgtaaccggagccagc
agggacttcctatccatcgcctggaagcctccgcagcaggacggcggttccccgatccgc
ggctatcacatcgagatgtgcgaggccggaactgagaagtggatgagagtcaactcccgt
ccggtgaaggagctgaagtacagagtggaggagggcatcgtccctgagaaggagtacatt
ctgagagtgagggccatcaattctgtaggagagagtgagccctccgacatctcagaaaac
gtctttgccaaagactctgactgtaacccaacactggagttccagactctggacctcgtt
gtggtggaaacagagaagcttcacatcccggttcccttcagagccgtcccgtctcccaaa
atcacctggcacaaagacggcaaggagctgaaggctgatgagcgtctcatgttcaggaag
gagtacacttcctgtcacctggagattgacagcagccttcaccccgatgctggagtttat
aaagtgactctggagaacaaactgggaagtgccagtgcaaccattaacgtgaaagtcatc
ggtcttcctggtccctgcaaagagattgttgcatcagaaatcacaaagagctcatgtaaa
gtttcctgggatcctccagactacgacggtggcagcccgattcttcactatgtccttcag
cggcgtgaggctggtaggaggacctacgtcaacatgatgtctggagagaacaaggtgagc
tggatggtgaaagacctcatccccaacggagagtactacttcagagtccaagccgtcaac
aagattggaggaggagagttcatcgaactgcgcaaccccgtcattgcagaggaccaaaaa
catgctcctgatgcgccagtggacgtggaaacccacaaccccacttccagcactataacc
ctgacctggaagcctcctatgtacgatggtggcgccaaaatcatgggctacattctggag
aggcagcagaagggcgaggacaagtgggagaggtgcaatgacttcctggttcctgtcctg
tcctacacagtcagaggactaacagagggcaagaactacatgttcagagtcaaagctgaa
aacgctgctggcatcagtgatccgtcacgcaacacattgttcgttaaggcctctgatgct
gttgatcctccaaaggttttcctcagtggtagcctgcaatccggtctcagtgtgaaacga
ggctgcgagatctgcctgaatgccaatatttctggctcaccgtaccctcagatcacctgg
tactggaacaaccaggtgatccaacctgaaccactccgcaagagacctgagaaacccctg
aagaagaagccagagaagaaggaggaggagaagaaagaaggagaggagaaaaaggaagga
gaggagaagaaagaaggagaggaggagaaaaagccagagggagaagcggagactaaagag
gagaagaaggagggagaggaaaagaaagaaggagaggagaagaaggaggaggagaaaaag
ccagaggaggaagctgctgagccagaggtggaggagcctgactatcccaccataaatgaa
cgtctgaccatcgataacagccacaggggcgtgtcctccatcgtcattaatgagtcagtc
cgcccagatcatggggtctacatggtgaaggtggagaatgaccacggcattgcctcagca
acctgcgaggtcaacgtgctcgatactcctggtcctcccgtgaactttaggtttgaggaa
gtgaggaagaactcagtcatttgcaagtgggatcctcctctggatgacggcggcagtgag
atcctcaactacaccctggagaagaaggacaactccaagctggagttcggctggagttgt
gttaccagcacactgagaggctgccgctacctggtgcccaagctcattgagaagaaagag
tatatcttcagggtcgtagctgaaaacaagtttggccctggtacaccatgcgtttccaaa
cctctcatcgccaagaatcctttcgaacctcccgaggctccagataagccacagattgac
gacatcacagccaacagcatgctggtcacttgggacgtaccaaaggacaatggcagccct
attctgggatactgggtggagcgcagggagatcaacagctcacactgggcacgtgtcaac
aggaacattgtcccagacacggagctgaacgtcgaaggtctcctggagggactcacttac
atcttcagggtggcggctgaaaaccaggccggccctggaaagttcagtcctccctctgag
cctaagacagcacaggctcctatcttgccacctggacctcccattgccagagtggtggta
accactgaccactccatcgaagtagagtgggatcctcctgccgacaatggtggaggagag
attcagggataccatgtggataaggcaatggctggtaccaaggactggtctagatcaaca
gaacgtccctggaagcagcgtaacttcaccgtctatggagttcgtgagggagcgaagtac
acagtcagagtcatcgcctgcaatgctgcaggagaaggaacacctggtttcacagacgct
gtttttgtccggaacccagcagagattccagtaattgacatggaccttgccatcaagaat
ggcataatcatcagagctggagaaacgctacgtgttcctgctacagtcactggtaaaccc
tatccatccatcacctggacaaaggatgatggcaaaccagataaagaccgtgtggagctc
ctcagtgagggcaatgacagtgttgtctcaatcaagaatgtccagaggcaggattgtgga
aagtatcagatctctgcctgcaaccccagtggctccaagtctgcatcaaccagagtggaa
gtgatggatgtccctggtcctgtcaaggacttgaagccagtcgttgttactcgtaagatg
attttcctgaactgggatgacccagaagatgacggaggcagcgatctgacaggctttctt
gtggaacgaagggatgccaagatgcacacatggaggcagcctgttgaaaccgcttcgtcc
aagtgcgagtgtgtaggaatcatggagggacaggagtacttcttccgtgtcatcgccaag
aacaagtacggtttgggtgttcccgttgagctgggacccatcaaagctgtggatcctcag
ggtccaccatcataccctgaaaagttccactacacagagaggaccaaaaactccatcact
ctggcatggaagccaccgcgcagtgatggtggcagcccagttattgggtactttgtagag
aagaagaggcaagaccaacaggcctttgaaccctgcaatacagagatctgccccaacatg
actctcactgttgaaggcctggaggaggcttggatgtatgagttcagaatcaagtgtgcc
aatcttattggagagagtgagccatccattccactgactgtagtaattcaagatgatgaa
gttggtcctgaggtccacatgctgaagcactttactgctgactgcattactgtgaagaag
ggtgagcctattgaaattcccgctgatatcattggactccccatcccaaagatcgagtgg
tccaaggacgacgtcctaattgacaagccgacagagacactgctgatggaaacagaggtg
actggaaggttgaatgccaagaccacactatccatcccagctgccaacaggagggaccgc
ggcagctacactgtgtcagcatccaacaacatgggctcagccaaacacaccgtctatgtc
atggtgcttgaccgaccaaccccacccaggaatctggctgtgtcaaatatcagggccgag
tcttgctacttaaactgggacccaccagttgataatggtggaagcgagctgaccaactac
attattcagaggaaggaagtgcgtaaagaccagcctgagccagaagagggagaagaggct
ccaccagagccgcagtgggaagtggtcaacaatgccgtaattgaaaggaaattaggggtg
tgggagttggacaccagcaagacctatctgttccaagtcagagccgaaaacaagtacggc
atatctgacccgtgtacaacggaggaagttcttatcacagatccatttggtcttcctggc
ccaccacagaaaccagctattgcagaatactccaagacctccatgacactaacatgggag
cctcctagagagactggaggctcaatgatcactgggtactggctggagaagagagagaaa
ggaacagactattgggccaaagttaacaagacgccagtcactaaaagaggcacgaaaggt
tgggagtatcaggtgactcgactgtttgaaggaactgagtacgaattcagggttgctgcc
tccaattcagctggaactggaccattcagtgggccgtctgactctgcctttgcagttgat
ccgatcactcctccaagcatgcctgctgctcctgaggttgctgataaaacgaagcatagc
gtcacgctgtcctggaagccaccggagagtgacggaggaagccccattaagggctacatt
atccagattcaggatgaaggctcatcagagtggcacaaaatcaatgacattgatagcctg
caccccaccacggagttcaccgtgcccagtctccgtgagttgaaacgctaccgcttcagg
atcattgctgtcaatgacatcggcgagtccgaccccagcccacgcaccagcgaagttctg
atagaggatgtccaacttcctcctgtcattacaattgatgtcatggctgaggaactagtc
aacattcgtgctggagatccaatcaggattcccgcaaccattaagggccggcctgctccc
aaggttacatgggactacgaaggcaaagccaagagcgagaaaaagaacaaactgcacaca
atccctgttgaggctcaggttgagtccacagacaccacctcagtcgtgaacattcctgtg
agcttgaggagtcattctggacgttacaccatcacagccaagaacaagtctggacagaaa
catgtcaacgtcagagtcattgtcgtcgatgttcctggacctccaaaggacctgaaggtc
actgatgtaacccgttccaccatgaggctgatctggaagctccctgacactgacggagga
gagaggatcaagagctacttcattgagaaaaagtctgtgattgacaaggcctggaccaag
gtgaatgccgcttgtgctagccaggcctttgtggttccaggcctgcttgagggtcaggat
tacctgttcagggttcgagcagaaaacagactgggatttggtccttttaccgagacaacc
gaacccatcagagccagagatcccatctacccacctgaccccccaaccaagctgaaggta
aacctagtcacaaagaacacggtcactctgagctgggagcctccaaagaacaacggcggc
tcacctgtaaaacattacatcatcgagcgtctgagttgggacaccagcagcaaggagaag
gaggcctggaagcagtgcaacaagagagacgtggaggagctcaccttcattgtggaggac
ctgaaggagggaggagaatatgaattcagagtaaaagctgtgaatgcagctggacccagc
cgaccttctgccactgttggacctctggtcatcaaggatcagacatgtcctcccaccatt
gagctgcgtgaagccatggagggcgaggagggctgcgacgtcagcatcgtggcgaggatc
agcggctgtcccttcccaacgctgacctggcacaaggccagcctggccaaacccgaggaa
aaggctgctgtccagtatgaccagcatatcaacaaactggtgaccccagacaagtgcaca
ctgttgatccagcaggccagccggaacgacagcgccctctacagcctgacggccagtaat
agcctgggtactgtctccaaggacatcaagctggcagtgctgggacctcctggcccacca
gtgggtccgatcaagttcacagaggtgtttgcggagaggatcggcctggcctggaaccct
cccacagatgatggtggatccaagatcaccaactatgtggttgagaagcgtgaggacaac
agaaagacgtgggtccacgtctccaacgacccgaaagagtgcgcctttgtggtgacacgt
cttacagagaaccacgagtacgagttcagagtcatggcccagaacaagtttggagtcgga
ccggcagtgatcagtgagcctgagaaggccagaaacctcttcaccgttcccggtcagtgt
gagaaaccaacagttactgaagtctgtctggagtccatgaccgtcaactgggatgagccc
aaatatgacggcggatcccccatcactggctacttcgtcgagaagaaggagaccacttcc
aaacgctggacccgtgttacccgggaaccaatccgtgcgctcccactgggcaacaactgg
gacgttacaggcctgctggagggcgccctgtaccagttcagggtgatcgccatcaacgcc
gccggctgtggtctgcctagcttgccctctgaccctgtactctgcagagaccccatcaag
cctccagggccaccttacccgaaggtgatggactggactaaatcaacggtggagctggag
tggctccctccctctacagacggagggtccaaggtgacaggttatattgttgagttgaag
gagataaacaaggaggaagaggagatgaaagccaagaggaggctgctgttgagcgaagct
gaggaagagaaggagcctgaaagcgacgagagctggaagaaggcaaaggacacagagatc
agaggaactaagtttgttgtgaccgacctgaaagaaggagggctgtaccagttcagagtc
cgagccgtgaactctgctggcgtgggagacccaggtctcgtgtctgagctgatcgaagcc
aaagacagaacaattcctcctgagatggaccttgatgcctcagtgaaggaaaagattgtg
gtccacgctggagccaccatccgcatcatcgcctatgtgtcaggcaaacccgccccgcag
atcacctggtgccgtgacgacgccgaggtgcccaaagaggccgtggtggagacgacgggc
atctctaactctctggtcatcaagaactgcagacggcaacatcagggcatgtacacactc
agcgccaagaacgagggaggcgagaggaagaaggccgtcatcgttgaggttcttgatgtt
cctggacctgtcggtcttcccttcgctggtgagaatctgaccaccgactcctgcaaactg
acctggtacttccctgaagacgacggcggctcggccatcaccaactacatcatcgagaaa
cgagagtccgaccgaatgggctggacctcggtgtcctacacggtgacgaggaacaacgct
gtggtgcagggactgatcgaaggcaagggctacttcttcaggatcgcagctgagaacatc
atcggaatgggacctttcatcgagaccgacaagatggtcctcattaaagacccaatctcc
gtcccggagcgtccggaggacctgattgtcacaggtgttagcaaggactccatctctgtt
gcctggagaccacccaaatacgacggtggtgcagaggtgacatcctacgtccttgagtcc
cgaatggtgggccgtgacactttcactcggatcggaggcgaggacaagctgatggacagg
aagttcacgctaactggactgaaggaaggctcgagtcacgagttcagagtctcagccgtc
aaccaggttgggcagggcaagcactccttccccaccaaacctgtgcagtgcaaggacgag
ctcgagccacctactttggacctggacttcagagacacgatgatggtcaaggtgggagat
ccatgcatgctatcaggacgttacagcggcaagccagccccgacaatcacctggacaaag
aacgacgaagagcttaaatcagacgaagagatcaaccttcacagcaccgcacgccacctc
agcctgaacatcagcaaggccaagagagaacacagtggccgctactgcgtcagcgtcgag
aacgccgccgggcctcgcaccggaatctgcaccatcactgtagttgaccgtcctcagcca
ccagagggccccgtagtgttcaacgaagtctacagaaactacatggtcatctcctggaac
cctcctctagatgacggcggctgcgccatctccaactacatcatcgagaagagagacacc
aacagagacctgtggatgcccgtcacctcttcctccaccagaacctcctgcaaggtgcca
aagctgatcgaaggtcgtgagtacatcatccggatcatggctcagaacatgtacggcatc
agtgacccactcctgtcagcggagaccaaagctcgagatgtcttcaaggtacctgatgcg
ccaaagcaacccacagtgaaggaagtttaccatgactgcgccctgatcagctgggagcca
cctgctgatggaggaaaaccaatcacaggttacattgtggaaaggaaggagaccaaggcc
agcagatgggttcgctgcaacacagaaagaatctaccccaaagtggagtactgtgtgatg
gagctgctgcaaggctgtgaatacgagtttagagtcagcgctgagaacgtagtgggagct
ggcgacccgagtccaccatccaaaccagtttttgcaaaggatcccatcgtgaaatctagt
ccacctgtcaacctttgcgccatcgacttcaccaaagagtcagtgactctgtcctgggag
ccgcccaccgacaccggacgaggcaagatcttcggatacctgctggagttccagaaggct
gggcaagaggaatggagcaaggtgaaccagactccagattcctgccaggagaccaggttt
aaggtgatagacctggaagatggtgctctgtaccgctttagagtcatggctgtgaatgca
gctggagagtctgacccaaccaacctgaaggagccaatcagagtacaggagagacttgag
cctccagagttgattctggatgctggaatggcccgagaggtgaaggccatggctggtact
cacatcaccctgatggccaccatcaaaggcgtgccattccccacagtcacctggaagaag
aacgatgcagaggttcctaccagagctgacattgagacaaaccaggctggtacaaagctg
gagatgagattctgcaaccgtggagactgcggagactacactctgacggtggaaaactcg
gccggttccaagactgctacctgcactgtgctggttcttaataaacctggtcctattcag
cacctccgggtgtctgacgtcagaagtgactccgcctacctgtcgtggaaggatccggaa
gacaatggcggctcacgcatcactaactttgtggtagagaagaaagacactgcatccact
cagtgggttcctgtctgctccacctccaagaagcgcagcatgatgctaaagcacctgatg
gagggcacatcctactcattcagagttgctgctgaaaaccactatggccgaagcgaattt
gttgagacaccaaaagctataaaggcaatgaaccctctcttccctcctggtcctcctaaa
gacctgcatcatgctgatgtggacaaaacagaggtctggttggcctggaactggcctgat
cgcgatggaggaagtgagatcactggcttctttgtggagtatcaggaagaaggagccaaa
gagtgggaagaatggaagactgtgagcatcccagagagtcatgttaccggcttggaggaa
ggaaagacttaccgctttagagtgaggactgaaaatgccattggcctcagtagacctgac
accacactgcccatcctctgccaggagaaactagtccctccaattgtcgaggtagatgtt
aagctgattgaaggcatcattgtgaaggccggcaccaccatcaggttaccagctataatg
agaggaatccctgttccctctgccaagtggtccattgacggggaggaaatcacgagccag
ggcaacatcaaaatcgatactgacaatttctcaactgtgctcaacatcaacgagtgtacc
aggaaccacacaggcacctacctgctcactgtgtccaatgcggcagggacgaaaaccgtg
gccctgagtgtaactgttttggatgttccagctgcacctattggacccgtcaacatcatg
gaagtcactccagactccatgacgatcgaatggcgccctcccaaggatgatggcggaagc
cccgtcaccaactacattgtggaaaaacgagagtccaacaaggagacttggggaggcgtt
agctctggcagccttgaaactcagctcaggattactcgcctgcagaaaggaacagagtat
gtggttcgcattcgtgccgcaaacaagatgggagtgggtgctccactggagagcaagcca
acggtggctgaacacactttcatgccacccagtccacctggtaaaccacagcattatgag
ctgtctgaggatgctgttacaatcggatggaccatgcctctagctgatggtggcagccag
atcactggctacctcatagagcgcagacataagggaggaaaatggatccgtgttaatagg
accccatgcaaggacctccgatacagagtccagggtctgtttgaaggaagtgaatatgaa
ttcagggtgtttgcagagaatattgctggctatagtggtccttctcctacctctgaccct
tgcaagccttgcagacccatctcagtcccaagctctcctataaatcccaaagttaaggat
tacagtaagaacactgctgacctggtctggaccaaaccctccaaagatggaggcagcccc
atccttggctacacagtggaaatgaagaaagccgataccgaggactggaagaaagtgaac
ctggatgacctcatcaagctgtgtgcttacagggtgaagggtctggaagaaggtgtgagc
tacagtttcagagtctatgcttcaaacatgattggagacggagagccaaaagaaatgcca
cagtcaatcactgctcaggatatcctcatccctcctgagattgaaatggaggctacctgt
cgcgatagattaaccgtgcgtgtcggccacaacatcaacatcattggctacatcaaggcc
cgtcctgatcctgaggtcatttggtcaaaggaggagacagttatggagaacagcaaacga
gtgaccatcatccagaacctcccggtggttcacctcagggtaaaagaagctacgaggaat
gatcatggaaaatacacactgaaggcttcgaatgagggtggtgaggcttcctgcaccatc
acagttaatgtcctggacagaccaagtcactgccagaatctgcacataacctatgccacc
aaggactcatgtatggtcaactgggaggcacccattgacaatggtgggtctgagatcacc
aattacattgtggagtgccgtgagcccagcattagcatgtggtccatgatctcttccaac
tgcaccaatcgcaagatcaaagccaaactgatggagggccatgagtacctgttccgcgtc
tgcgccgtcaacaagctgggacctggccccagtgtggagatcaagactcctctgctggcc
atcgaccccattgagaagcctggtgagccggagaactttagagccaccgacattggtaaa
aactttgtctatctgagatggaggaagcccgactatgacggtggcagccccaacctctcg
tacaatctggagtgcaaacacaaagatgctgaacagtgggagaaactcaacactagtaca
ctaacggatacctttttcttggctgccaagttggttgaaaaccaaacctacacattcagg
gtacagactgtgaatgaaggcggagaaagtgcatgggtaaagatccctgacattgtggtg
agggaggagatccagaagccagtcattgacctgaaggtagctggaattgtgacagtgaag
gctggagagtcagtcaggatggaggctgccctgagaggaaaaccgcagcctgaagtcaaa
tggacaaaagacaaagctgtgggagacaatcccagaatgagctatgaaactggttcagat
tattccaaatttcttctgaccaagtccagacgttcagacaccggcaagtacgtcatcact
gccactaatacagctggcaccttcacagcttatgcaaacgtcaacgtcttggatgtgcct
ggaccagtgaggaacctgaggatcaccggcatcggagctgacaaatgcagagtggtgtgg
gacggtccagaggacgacggaggctgcgaagtggacagttacattttggagaaatgtgag
accaggagaatggtctggtccacatactccgcctctgtagtcactccttactgtaacgtc
acccgactggtggaaggtaatgagtacatcttcagagtgagagcagagaacaagatggga
actggtcctgccatggaaagcagacctgtaactgtcaagactcagttcaacagacctgga
ccccccgacacccctgaagttactaaggtcagtaaggaggagatgactgtggtctgggct
ccacctgagaacgatggaggaaagtccatcaccggctacattctggagaggaaggagaag
cgggcggtgcgctgggtggcttgcacgaagagccccatctctgaaagacgcatgaaagtg
acaaacctgattccaaaccatgaataccagttcagagtgaaagcagagaacgaagtcggc
cttggagaaccaagcaaaccctgcagacctgttgcagccaaagatcctattgaaccacct
ggaccaccagcaggcctgaaggtttctgacagcacaaagacctccattaccctgtcctgg
tctaaacccgtgtatgacggcggcgcccccattattggctacagcctggacttgaggctg
aagagcgacgccgacccagagaaaccctcagagggctggaagagaatcgatacccgtggc
ccgctggtgatcacagagttcactatcggccagttggatgagaaacaggagtatgagttc
aaagtctccgcccaaaaccaggtgggctggggtcgccacgcctacctgaaggaggcagtg
tctcccaaggagatccttgaggcccctgaaatcgagctggatgccagtttgaggaaaggc
ctcgccgtcagggctgggtgtcccatccggttgtttgctgtgatcagaggaaggccggca
cccaaggtgacctggaagcgcctgggtgtggacaacgtcatacgccgaggtcacgtggac
caggtcgacaccatgtgcttcctggtgatccctgagagcaccagagaggattctgggaga
tatgcattgactctgtccaactcggctggagagaaagcagtgtatgtccgagtcaaagtt
cttgacactcctggtccggttggcggcttggacgctaccaacataactaagacaaccgct
caactctcctggttgcctccggaaaatgatggtggcagccccattattaattacattgtg
gagaaacgggaagtggatagaaagacttggaccaaatgcatagaggacctgaagaaaacc
agcttcaaggtgaccagcatgacgccaggcatcgagtattacttcagagtcatggcgtgc
aacaaatatggaattggagttcctcaggattctcccaggtcctatctggctgtggatcct
ataagtgagccggacccacctaagaagatggatgtgttggagatttcaaagaacagtgcc
acgttgggctggctgaagcccctcagagacggaggagctaagatcaacggttatgtcgtt
gattatcaggaagagggagctcccgaggacaagtggacaccttactctgtcgtcaaagat
ctgaccattgtggtggttggtctgaaagaaggaatgaagtacaagttcagagtggcagca
aggaactcagtcggagtaagcttggctcgcgaggcggagggagtgtttgaggtcaaggag
cagctcatggctccaaagatcatcatgcccgagattgttacggtgagggccggatcgaaa
atggtgattgagggcattgtggctggtaaaccggctcctttctgcaagtggaagcagggc
aacgaggacgtactgacctcagatcgcctgtcggtcgtaaagactctgacaacctgtacc
ctcatcatcaagaatgtgaacagaaaggacagcggctactacagcctgtctgccgagaac
agcaccggcaaggtcaaccagatcctcagatgcatcgtccaggacatccctggacctcca
agtggccctctggagatctcagaattggatattgatgcttgcacgctgctctggaactcc
ccggaggaagatgggggcagcaacatcaccaactacattgtggagaagtgtgacatcagc
cagggtgactggatcaccgtttcagtttcctgcaccaagaccagcttccgaatgaccaaa
cttacaactggaaaggagtactggttcagggtccgggctgagaacaagtccggcatctct
gagcccctctactctgagaagatgattgccagatatccgtttgatcctccaagtgaaccc
agaaacctgcagatcaacaagatcaacaaggactttgtcattctgtcttgggagcgtccc
agcagtgacggtggaagccccatcactggtttctgcatagagaagaaggagaggaacagc
ctgctgtgggtgaaggctaacgagtctgtggtcaaagccacgcagtacacctgcaccggc
ctcatcgagggcctggagtacaccttcagggtgtcggcctacaacatggctggacaggga
aaaccctgcaaacagaccgacttcatcaccgccagaactgcaattgacccaccaggtaaa
cccgaagcaatggatgtgaccaagaactctgtctcattggtctggagccgtcccaaacat
gacggtggcagcaagctgattggctaccatgtggaatacactaaggtgccagaggacaaa
tggacttgctgcaatgccaactgcatgaacatccggactgagagctacgtggttcagggc
ctggaggagggtcagaggtaccagttcagagtcattgccaagactgccatcaacgtcagc
ctcccgtctgaggtgtcggatcccattgctgtcattgctgagaatgttcctccccgcgtt
gaactgggcgtcaacatgaagagcctcattgtggtaaaggcaggcgacaacgtcttcctg
gatgctgaggttcacggcaaacccctgcctaaggtgagctggaagaaagacggtgcgcca
ctggtgatcacagagggaatgaaggcaacgcagaagaaacacgttcatctgctggagctc
tactcagtcaccaggaaggagactggagactacaccgtcctcgctgaaaacctgagtggt
agcaagtatgccaccattaaggtcaaggtgctggacaaacccggccctccagcctcaata
aaaatcgccaaagtgtttgctgaccgtgtgaagattcgctgggagcctccactcgcagat
ggaggatctgaaatcaccaactacattattgagaagcgtgaaaccagcagggccaactgg
gcgctggtaaccgctaacatccacggccacatcaccgactgctcagtggaaaagctcatc
gagggtcatgagtaccagttcagagtgagtgctgagaaccagtacggtgtgggagacgcc
accatgactgacgccgtaaccgtgaagaacccatacgatgttcctgggccatgtgagcca
ccggtcattaccaacatcaccaaggactccatgacagtcagctggaaagcccccgccaat
gacggcaaagctcccatcctgggttacctggtggagaagcgtgaggccacagagttggcc
tgggctaaggttaaccgccgacccgttatcgacagaaccatcaaggcagttcagctgacc
gaaggctcagagtacgaattcagagtcatcgccttgaacaaggccggcctgggcaaaccc
agcgatccgtccaacgccgctctggctgttgaccccgtctatccgcctggcccacctgcg
ttccccaaggtggtggactctaccaagcattcgatcagcctcagctggaccaaaccagct
tacgatggtggctgtgagatcattggatatctggtggagtgcaagcaagccgacgccgag
gagtggaccaagtgcaacgtcccgaagaaactccaggccaccaaattcgtggtgaccagc
ctgatggaaaacacagagtaccagttcagagtcattgccgtcaacaagattggctacagc
gaccccagcgaggttcctggaaaccacatggccaaggacatcctgattgcccctgaaggt
gagctggatgctgatctgaggaaggctttggttctgcgagccggcatcaccatgaggctg
tacgtcccgctgaggggacgcccggcgcccaaggtgacatggacaaaggtggacgccaac
ctgaaggagaggcagggcctgctgatcaagacgtccgactgggacaccctgctaatgatt
gaggacattaacagatatgatgcaggcaaatatgtcctgtctctggagaatagcagtgga
tctaagagctacaccatcattgttaaagtcctcgactcacctggaccacctgccaacctg
actgtgaaggagacctccaggacccacgcctggataagctgggagccaccgctgatcgat
ggtggaagtccagtaaaaagctacgttgtggagaaacgtttggctgagaggaaggcgtgg
acctgcgtctccgctgagtgccacaagacttccttcaggatcaccaatctggagccgggt
caagcatactgcttcagagttctggctgaaaacgcttatggcatcggagagggctgcgag
acggcaggcagcgtccgggcctccgaacaacctggtccagtgacagacttcagagcccaa
aagaccaccaaagactctattacattgagctggaagaaacccattagtgatggcggaagc
tacattacctcttacatcctggagcagagcgaaggagaggagaaatggaaggagattatg
aagggcaagaacaccagtcacaccatcagtgagctggcagatggcaaggagtatttattc
cgggccaaggccctcaacgagtctggagaagggccaccaactgagctcactgctgttgcc
aaggaccagtttgtgctgcctgactgcaacttgagcagtcttcatgatggttgctgcgtg
gtgaaggagggcaccaccatgcgcatcaacatccctgtcattggagtgcctcaccctacc
gccacctggaagaagggcgacatgggacttggtgacactggccgtatatgtgttgaggcc
tcccagggcattaccactctactggtcagagactgccagagaggagatgcagatacctac
accatcaatgtcaggaatagcgcaggctcaaaggactgcaagttccagttgaaggtcgtt
ggaaagcccggattatgcactggacccatcaagtttgacgagataactgctgatggcatc
accctggagtgggcaccgcctaaagacgatggaggtgcagaggtgtccaattacatcgtt
gagaagaggaggacaacagacaacaaatgggccacggtggcttcagccatccagaagacc
accatgagggtgatcagactccacgatggaatagagtacatcttcagagtgtgtgctgag
aataagtacggcatcggagagttcctgaggtctaacccagtcattgcccagcatcctttc
aatgtacctgaggcgccagctcctcctgagattctgagcattcgacatgagtcagccatt
ctgacttgggctgatccaaaagactctggtggctccccaatcactgggtatcaccttgag
tttaaggagagaaacagcctgatgtggaagcgagctagtaagactcctttgagagtaaag
gagtgtagagttacgggtctcgttgaaggactagagtatgagttcagggtgatggctatg
aatgtggccggccttggaaaggcaagcaaagttactgaggctgttgtcgcccttgatcct
attgatccacctggtaaaccagatgtgattaatgttaccaggaacacagtcactctaatt
tggactactcctaaatatgatggtggctataagctgactggctatatggtggagaaactt
gaggctggtggaaaggcatggatgaaggccaatcacgtgaacatccagagctgtgctttc
accgttacagacctgacagaaggagctcagtatcagtttagaatcagggccaagaatgct
gctggtgctgtcagtgttccctcagagaccactgaatcactgacctgcaaggatgagtat
gagcctccatctatcactcttgaccaagagatgaaggaggttgtgtctgtcaaggcagga
gacacaattgttatctcagctgcaaagattgtgggcaaacctcccccaactgctttctgg
tccaaggggggtcgtgaattcaagaactctgacattgtcactgtaactagcactccaacc
tcttcaaccctttctatcaagtatgcaagccggaagaatactggagagtacacaattaat
gctagtaacccatttggtattaaggaagaacacattaaagtaaaggtcctagatgttcct
ggaccaccaggccctattgaagtcagtaacatttcagctgagaagtgtaccctgacctgg
cttccacctgaagaggacggaggctcctctatcaagtcctacatccttgagaagagagag
actagccgcttgcagtggaccaaagttgcggaaaatattatggactgcagacatgtagcc
agtaaactgatcaagggcaatgagtacatctttagagcgtgtgctataaaccagtatggc
acaggagactctagcctgtctggtcccgtcaaaatggctgacagctttggtccaccaggt
ccaccctcagctccagaggtagataatgtcagtcggaatgctgttaccatttcatggaag
agacctgtacaggatggaggaagtgacattagaggatattgtgtagaaaggaaagaaaaa
agaggaatgagatgggtgagagcctgcaagaggacagttcctgaccttcgcttcaaggtg
caaggcctgagtgagggagtagagtatgagtttagagtcactgctgagaataaagctgga
tttgggccgccaagtgagccatcgcgccctgtaatgacaaaggatattgtatatccacct
ggtcctccatccaaccctagaattacagaaaccacaaaaactacagcagcctttgcttgg
ggccgtcctcattatgatggtggtcttgaagtagaaggttacattgttgagtataaaaag
gagggtcatgatgactgggagacagagacacaatatccagttaaagttactgaatatgtc
attggtaaacttcaaaaaggaggcaaataccacttcagagttagtgctgtaaactctgag
ggagtcggtgagcctgcagaggtcgagaaagtgactgaactagtttaccaggaaacgata
ccagactttgagttggatgcagagctcaggaaaactctggttgtcagatgccgtgcttca
attcgtctatttgttcctatcaagggccgtcctgttcctgaagtcacttggagcaaagaa
aataccaacctgaaagcacgtgcacacattgatacaacagagtcctacactctactggtt
attcctgattgcactaggtacgacgcaggaaaataccatctctctttggagaatgttgct
ggtaagaagtcaggctttgtcaacgtgaaagttctggacacacctggacctccagtcaac
cttaaaccaagagagatcactaaaaacagcataactctccagtgggaaatccctattatt
gatggagggtccaagattcataactacataattgaaaagagagatgctacaaagaaggct
tatacagtgcttagcaccacatggcaaaagtgttcttttaaatttcaagaccttgaggag
ggagcttactactacttccgtgtttctgctgaaaatgaccttggtgtaggtgaacctgct
gaaacccctgagcccataagagtatctcaagccccctctgcaccagataacttgtatgtt
actgatttgaccaatgacagcgcaagtcttgcatggaccaagcctcttcatgatggcggt
agcttgattacaggttatgtcattgaggctcaaaagaaagacactgatcaatgggtccac
ataaccaccattaaggctctagattatactgtgacagatctgattgagggtgctgaatac
atcttccgtataatggctgtcaatgcatcaggcaggagtgatcctcgtgagagccggcca
gctgtgattaaagagcaaacttctgctccatcttttgacctgagaggagtctaccagaaa
actgtaattgccaaagcaggggaccgtgttaaggtggagattccagtgttgggaaaaccc
aggcctgttgtgtcatggaagaaaggagacatggctcttaaggaaacacaaagaatcaac
actgaaaccacagcaacatcaacaatcctaaacatcagtgagatcaaaagaactgatgaa
ggccagtattccatgactggaaagaatatcctgggcacactgacagaaaccatcacagtc
ctggtccatgacattccaggtcctcctactggtcctgtcaagctggaagaggtgtcttgt
gattatgttattatgtcctgggaaccaccagagaatgatggaggtgttcctataaacaat
tatattgttgagatgcgtgagactacaggtacttcatgggtggagttggcagctacagtt
attcgcaccacattcaaagcagcacgacttaatactggaacccagtatcagttccgtatc
aaggctcagaacagatatggcgttggaccatgtgttctgtctgaaccagtgtttgctgcc
tatccatttgatgtgccaggccagcctggcattcctgtagttacagctttcaacaaagat
tcaatgactcttagttggaatgagccatcttctgatggaggcagtcctattcttgggtat
catgtggacagaaaagagaaaaacagtatcctgtggcagaggatcagcaaagctcttgtt
attggaaacatctttaaatcatcaggccttgttgatggcattgcatatgaacaccgtgtc
attgctgaaaacatggctggtctcagcaaacctagcaaaccctgtgaggctacatatgct
ttggacccagttgactcaccaggtaggcctgtggcattgaatatcaccagacatgaggtg
acattgtcatggaccaaaccagaaggtgacggaggattttctattacgggatacacagtg
gagaggaaggagatgcctaatggacgctggcttaaagcaaatttcaacaacattctagaa
accatgttcacagtcagtggtctgactgaagaggcaacctatgagttccgtgtgcttgct
cgaaactcagctggtgctgttagtgctccatcacagccatcagaagccatcacatgcaga
gatgacattgaagaacccaggcttgatattgatgcatcatatagcagtaatgttgtagta
atggcaggagaaccattcaagttggaagccagtgtaaccggcaggccaattccttctcta
gtatggaccaaggaaggaaaggagctggaggacacagctaaaatagaaattaagacatct
gacttccacacaaccttaatcggcaaagattctctaaggagagacggtggtgcttttacc
ctgactgcaagcaatcctggtggatttgcaaagttcacttttaatgttaaagtactcgac
agacctggaccaccagattccctttcagttacggacgttgctgcagaaaaatgtgtgctt
aactggctgcatccaacacatgatggtggtgccaaaattgaatacttcatcatacagagg
cgtgagaccagtaggttggcatggacaaatgtagccacagaccttcaagcaaacaggttt
aaggtcacaaagcttcttaaaggaaatgagtatattttcagagtaatggctgtcaataag
tatggcataggtgaaccccttgaatcagagcctgtgacttgtgtcaacccatatggtccc
agtgacccaccaacgcagcctgaggtcacaactatcaccaaagactcaatggttgtctgc
tgggagcgtcctgaacatgatggaggcagtagaattaatacatacataattgaaagaagg
gataagacaggtctacgttgggtgaaatgtaacaagaggactgtgacagatttgcgattc
aaggtctctggtctcacacaaggtcacgagtatgaatttagagtttttgctgaaaataat
gctggtctcagtaagcccagctcttctagtccattctacaaggctgttgacacaatcttt
cagcctggacctccaggaaacccaagagtgcttgacacctctaaatcatccattactatc
gcctggaataaacctgtttatgatggtggttctgaaatcactggttacattgtggagact
tgcctgcctgaggaggatgagtggacaattcatactcctaagaaaggatggacagccaca
tcttttaccattactagtctgaaagaaaaccaggagtataaaatcaacatctgtgcaaca
aattctgaaggggtgggagaacctgctgctgtacctggaacccctaaggccgaagacaga
ttaatttcgcctgaaattgaacttggagctgagctacgtaaagttgtttccatcagagcc
tgtagcacactcagactttttgtccccatcaagggaaggccagcaccagaagtaaaatgg
tcaagagagcatggagaatccctggacaaggctaacattgacattaccccatcattcaca
actcttcagatagacaatgttgacaggtttgatggaggtaaatatttggtgacagtagag
aatgcctcaggaagtaaaacagcttttgttaatgttagagtactagatactcctggacca
cctcagaatctcattgttaaggaggtcacaagagattcagtttccctggtttgggatgca
cctctcatagatgggggctccagagtccgcagctacattgtggagaagcgtgagtcaacc
aggaaagcctactcaaccgtatgtgccagctgccataagtctagttggaaagtgggagac
ctggaagaaggaaaattgtacttttttagaatagttgctgaaaacgaattcggtattggt
ctcccagttgaaaccattgaaccaattaaggcatcagaaaagcctctgccacctggcaaa
gtatctctccttgaagttaccggaagaagtgtcacactaacttgggaaaaaccagaccat
gatggaggaagcagaattacaggctataatgttgagatgcaatgtaaaggaagtgaaaaa
tggacacaagtgatggtggtaaagacaaacgaggcccaagtaactggactcacatatgga
gaggagtatacgttccgaatctctgcattcaatgaaaagggtgttagtgacgcccggcct
ctcaatgtacctgtggtggctaaagatttagtaataccaccagctttcaaactgattttc
agcacattcagtgtactggcaggagatgatcttaagattgatgtaccatatgttgcctgt
cctaaggctactgcaacttggctgaaggatgatgtcattctcaaagaaacaacaagagtt
aatgctgaggccacagacaaaaacctccttcttatcattaaggaggcttgcagagacgat
gtgggcaaatatactataaaactaaacaatactgctggggaggctacaacagatatcagt
gttgttgtcttggacaaacctggtcctccaactggcccgatcaagctggatgatgtcaca
gcagacagtgttgtcttgtcttgggatccaccacaatatgatggaggttgctcaatcaac
aattacattgtagagaagagagatacctcaactacaaactggcagattgtgtctgctact
gtagctagaacaaccatcaaagcggctcgtctgaagactggttcagagtatcaatttcga
attgctgcagaaaatagatatggcaagtcatcttttctaatttctgatagcattgttgcg
cagtatccatttgaggtgcccagttcaccacgatctgttgtggtaaagtcagccaccaaa
gagaccatgactgttgtgtgggagaatcccagcaatgacggtggaagcaaaattctgggc
taccacttagaacttaaagagagaaacagcattctctgggtgaaacaaaacaagcagata
atcccagaaaccagatttaaagtggttggacttgaagagggcattgaatacgagtttaga
gtgtatgctgagaatatcgttggcctcagcaaacctagcaaggtgagtgaaatccaagta
gccagggatccttgtgacagacccggaaaaccagaggctgtcattgtaacaagaagccaa
gtgacactgagatggaccaagcctgaatttgatggtggcatcaaaatcactggttatgtt
gttgagaaaaaagaggcaagtgggcgttggatgaaggccagttttgccaacattattgaa
actgaatttgttgtcacaggacttactgaggatcaaacctataatttccgtgtcattgcc
aaaaatgcagccggtgtctttagccaaccatctgattcttctggatccatcactgccaag
gatgagattgatccaccaaaaattgacctggaagctaaatactcccaggttgtggttgta
aatgccggagagacatttaaacttgaggctgctatttatggtaagccagtgcccactgta
cactggctgaaagaaggtactgagattacagaagcagctcgtttagaaatccataatacc
gatttttcagcttgtctaattgttaaggaagttattcgtgttgatggaggacagtacaca
ttgctggtaaagaatgttggtggagaaaaagttattaacattaatgtcaaggtattggac
agaccaggtccacctgagggccctatctctatttatggtgtcaccagtgagaaatgttca
atttcctggaaacctcccttgcaagatggaggtagtgatatctcccattatattgttgag
agaagggaaaccagcaggctggtatggactgtagttgagcaaaaggttcagaccctaaat
ctaaaaatcaccaaacttcttcctggtaatgaatacatcttcagagtgatccctgtcaac
aaatatggtattggtgagcctttggaatctgagtcgatgattgccaaaaatccatttgtc
gcaccaagtccaccaactgacgtagatgtttcttcaattactaaggactctatggtggta
acctgggagagaccaaataatgatggtgggaattccattcaggggtatgtcattgagaaa
cgtgataaggatggtgtgagatggacaaggtgcaacaagcgcagtgtgacagagttgcgt
ttcagagtaacaggactcatagaaaaccatagctatgaattcagagtagctgctgagaat
gctgctggaattggtacacctagcacaccaacagtgtactacaaagcattggatcctgtt
ttcaaaccaggcccacccaacaaccccaaggtagtagacacttctaggtctactgtatct
cttacatggggtaagcccatatatgatggtggaagtgagatcaaggcttacattgttgaa
gcaaatgatgtagcagctgatgagtggtttatgtgcactccacccactggaataacagac
actaaattcacagtgaaaaagcttctggaaaagcatgagtaccagtttagagtttgtgga
atcaacaaaattggtgttggtgaacatgctgatgtgcctggtaaaatacttcttgaagag
aagcttgaggctcctgaccttgaattagatgctgatatgagaaaaatgatcaacatcaga
tcagcttgcacactcaggttgtttgtacccgtgaaagggcggccagctcctgagctgaaa
tggggaaaggttgaaggtgagattaaagagactgcccaaattgacaacacaggaagctat
gcttcacttaccattgagaatgttgaccgatttgacagtggcaaatacacactgactgca
gagaatgccagtggagttaaatcagtgttcatcagtgtcagagtcctggattctcctagt
ccaccaactaacttaacagttaaagagattactaagaactctgtcactctttcatgggaa
cctccacttctggatggtggttcaaagattaagcattatattgttgagaagcgtgaaagc
acaagaaaggtttatactaccattacaacatgtaacaagatgtcatggaaagttgaacct
cttccagagggtggaatcttcttctttagggtcttggctgagaatgaatatggtgtgggt
ctccaagctaaaactatggagccaattaaaatatctgagaagcctcagccacccggtaag
gttagtgttcttgacgtcactcacagtactgttactctaaggtgggagaaatctgaacat
gatggtggtagtaggatcagttattatgaaattgaaatggctcctaaggacagtgaggca
tggactgtgtgtgctagtgtaaaagggcttgagacagtagtgagcaaccttctcaaggga
gaggaatatcagttcagagttgttgctgtaaatgagaaaggtaaaagtgacccaagacaa
ctggctcaatcagttgtagccaaggacctaatcattgaaccttctgtgagacccaaatca
agttcctacagtgttcaggtgggaaatgacctcaagatagaggttccagttgctggtcat
ccaaaaccaaccataagctggactaaggatggagtggcacttaagcagaccaccagagta
aatgtcagtgactcagcacatcacaccactctaaccataaaggatgccaccagagaggat
ggtggtatgtacactgtcactattgctaatgccttgtgttccaaggatgccactattgaa
gttatcaccctggataaaccaggaccaccaacaggtccaatcaaaattgatgatgttagt
gctgaaagtgccactcttaattgggaacctccctcatacacaggtggctgtccaatctcc
aactatgtagtggaaaagagagacacaactacaaccaattgggttgttgtgtctgccact
gtggctagaacaactttaaaggttgccaatctcaagactggtggtgaataccagtttaga
atctttgctgaaaacagatatggaaagagttacgcaattgattcagtgcctgttgtagca
caatatccattccaagaacctggaccaccaggaacaccatttgtttcctcatacactaaa
gactacatggtggtcgagtggcataaacctccatctgatggaggcagtgccattttgggt
tatcatttggagaggaaagagaaaaatagtatcctgtggacaaagatcaacaaaatgctc
attcaagattgtaaattcaagtctactcctcttgaggaaggcattgagtatgagtataga
gtatatgctgagaatatagttggcattggaaaatgcagcaaagtctcagaagtttatgta
gcccgtgacccatgtgatcctcctggccgtccagaggctgtaattgtaaccagacactcg
gtgatgctgagatggacaccccctcaatatgatggtggaagcattgtaactggctattta
atggagaaacgtgaccttccagagggaaaatggatgaaagctagtttcacaaacattatt
gaaaatgaatttacagttactggccttacagaagacagtaaatatgacttcagagtgatt
gcaaggaatgccgctggtgctgtcagcaagccctctgagagcacaggatccataacagct
aaggatgaagttgagccacccaagtgtgaaactgatcctatatacaatcagacaattgtc
cttaatgctggagagactttcagtctggaggctagtgtagaaggaaagcccatcccaaca
gcccagtggttcaaaggaagtgttgaagttgaaaactcagcaagagctgaaattaaaaac
actgattttaaagcattacttgtagtaaaggactccatcagagtggatggcggacagtac
actttggttctgacaaatgttgcaggaactaagacggtcccgttcactgtgaaggttctt
gatagaccaggcccatccgagggacccctcacagtcagtaatgttactgaggagaaatgc
tcactgtcatggctgccacccaggcatgacggaggagcaagcatttctcactacattatt
caaaagagagaaactagccgcttggcttggactgtggtctccagtgattgtggagctaca
atgttcaaggttaccaaactattgaaaggcaatgagtacatcttcagagttttggctgtc
aacaagtatggagtaggggaacctctggaatctgagccagttatcatgagaaatccattt
gttcctcctggttcaccttgtgaactagaaatcactaacattactagggattcaatgact
gtttgctggaaccgcccacagtctacaggaggaagtgacattgctggttacattattgaa
aagagagacagagctggagtgagatggaccaagtgcaataaacgtagagtgactgatttg
cgttttagagtaacaggtctcactgaggaccatgattatgagttcagggtatctgctgaa
aatgcagctggagtgggccagccaagcccacctacaccttatctcaaagcctgtgaccct
acttttgaaccaggtattcccactaatgcccacgtagttgacacaacaaaagattccatc
agcttagcttggcacaggcctatatatgatgggggttgtgaaattcaaggatatgctgtt
gaaataaccaaggcagaagaagaggaatggactatttgcacaccacccactggagtgaat
cttaccaagtttaccatcaaaaacctgatagaacatcaagaatacaaggtgcgtgtctgt
gctatgaataaaattggtgttggtgagcccaccgaaattctgggagttgtaatccctgtg
gataaaattgaccccccagagatgattttggattcagagctcaggaagggaatagttgtt
cgtgcaggaggctcaatgagaatctgtgtgccttttaagggccgtcccactcctgacgta
agctgggctaaagaggatggtgaactgcccagtaaagcacagattgagactgctgaacat
ttcacacagctctctattgacatttgtgataaatatgatgctggaaaatacatcctcaat
gtagcaaacagtgctggtagcaaatcagcttttgtctctgttaaagttctggacactcca
ggggctccattaaatcttaaagttaaagacataaagagggagagtgtcactttgacttgg
gaaccccctgtaattgatggtggctcaagaataaagaattacttggttgagaagcgtgag
tcaaccaggaaggtgtactctaatgtagacaataaatgtacaaagacaagttaccgtatc
acaggtcttactgagggaacgatttattactttagagtcttagcagaaaatgaatttggt
gttggacaaccagttgaaacaaaagaatctgttaaaacatctgagccacctttatctgtg
ggtaaagttaatttgactgaagtcacaaaaaccacagcctcactctcctgggagaaacca
gtccatgatggaggcagcaggatcattggatactacattgagatgcagcctatgggatca
gaagaatgggttgtggctgccacaactaagacctgtgagggtactgttactggtctaagt
gcaggacatgagtacctttttagagtatcagccttcaatgaaaaaggaaagagtgaccca
aggcctctggctgcagcagttactgctaaagatgttactgttgaacctggattcaagatg
agattcaatacctacagcttacaacaaggcgaggatctgaaaattgagattccagttctt
ggacgtcctgttccaaaggttgaatggaaaaaggaaggacaacttcttaaagagacaact
agaataaatgtatcaagcacaccatcatctacaaagttggtaatcaaagatgccagtaaa
gaagatgctggcaagtacactattacagcaaccagcagcattggaacagctacagaggag
attactgttatcattcttgacaaacctggacctcctacaggccctgtgaagattgatgaa
gtgagttctaattttgttactctctcctgggaaccaccagagtatactggaggttgtcag
atcaacaactacattgtagagaagagagacaccactactactgtgtggcaaattgtttct
gctacaatagccaggacaaccataaaagtcagcaatttgaagactggcactgaatatcaa
tttagagtctcagctgagaatagatatggaaagagttcagctattgtctctcctgctgtg
gttgccaagtatccattcagtgagccttctgcccctggaataccagttattacatctgca
accaaagagaacatggttgttgaatggaaaccccccaccaacaatgggggtagtccaatt
ctaggctatcacctggagagaaaggagaagaacagccttttatgggccaaactaaacaag
cttcttattccagatgcacgatttaaaaccacagaattggaagagggtatagagtatgaa
tttagagtttatgctgagaacattgctggcctcagcccagctagcaaggtctcagagagc
acagtagccagggatccatgtgacccaccaggcactcctgaggctattgaaatcaccaga
aaccatatcacacttcaatggaccagaccccagtacgatggaggcagtgcaatcactggg
tatttgattgagaggaggaagcacccagataaacgctggatgaaagcaagcttcaccaac
atcattgatacccaatacactctcactgggctcactgaggatcgtgtttatgagtttaga
atcattgctaggaatgctgctggtatttctagttgcccatctgaaagcacaggagaaata
acagctaaagatgaaattgaggctccagatgccaccatggattctaagttcaaagatctc
acagttgttcatgctgatgagacatttatcattgatgctgattacactggtaagcctctg
cctgaggtcacatggttaaaggatggaaaggaaattgacaaagctacagcaagaatggaa
atcaagaccacacttacccgcaccatcctgacagttaaagactgtatacgagttgatggt
ggccactttgttctcaagcttgttaatgtgggtggagtcaaaatgatcccagttaatgta
aaggttttggacagacctggtcctccagatggaccattagaagtgaaaggagtgacagct
gaaaaatgttatctgcactggagccatccttcacatgatggtggagctagcatctctcac
tatatcattgaaaagagggaaaccagtcgtttgtcatggaccatggttgagccaaatatc
caggcaatcagctacaaaattacaaagctgcttcctggaaatgaatacatctttagagtt
actgctgtgaataaatatggagttggtgaacctttagaatctgagcctgttgttgcccgt
aatccattcaccactcccagtgcaccctccactcctgaagaaagtgctattactagggat
tccattgtgcttacttgggagaggccagagaataatggaggagctgagattgaaggatat
gtacttgaaaaacgtgataaggatggcgtcaggtggaccaagtgcaacaagaagagactg
actgacttgagatttaggtgtggtggtctcacagagggccattcctatgaattccgggtc
tcagctgaaaatgccgcaggtgttggaaagcctagcacaccgacacagtacatcaaagca
tgtgatgccacttatccaccaggacctccaaataaccccaaagtcactgaccattccagc
acgacagtctccctttcctggtcaagacctatctatgatggtggagcacatattactgga
tatgttgttgaaatgaaggaggcattagatgatgaatggattgtttgcacacctcatact
ggtgtccaagacactcactacactgtaaagaagttaaaggagaatgcagaatacaatttc
cgcatatgtgccatgaactgtgagggagtaggggatcatgtggacctcccagggtctgtg
attgcggcagagaagttgcaggctcctgaaattgaactagatgctgacctgagaaagatg
gtcaatgttcgtgccactgcaacactacgtctttttgtgactatcagaggaaaacctgag
cctgaagtcaagtggtcaaaggctgatggcactctaaatgagcgtgctcagattgaagtc
acaagctcatacacaatgcttgtgattgaaaatgttgacagatttgacaccggcaaatat
gtactaacccttgagaaccttagtggctctaaatcagcttttatcaatgttagagttttg
gattcacccagtgctccaacaaacctacaagttaaggatgtaaagagacattctgtctct
ctttcctgggagcctcctctgattgatggtggagcaaagatatcacactatattgtggag
aagagagagcagaagcgaatggctttcaccagtgttagcaccaattgtgtaaggaactca
tacattatttctgacctgcaagagggagttagatactttttccgtgtgttggctgtaaat
gagctaggagttggtctgtcagctacaacagatcaagtcaaagtttcagaggcacctttg
ccccctggtaaaataactgtggttgatgtgactcgtcacactgtcaccctttcatgggaa
aaaccagatcatgatggtggcagcaaaattacaagctacatagtggagatgcagcctaag
ggagatgaaaaatggacagtgtgcagtgacgctaaggcactagaagctactattgaagga
cttattactggtgaggaatactccttcagagtaactgctgtgaatgataagggtaggagt
gataccaaacctctggctatgcctgtgttagtaaaagacatcacaatggaacctaccatc
aacttgcttttccatacatacactgtaaaagcaggagatgatttgaaaattgatgttcct
ttgaaaggcagacctcaacctgaggtatcctggaagaaggatggcagtgcactaaagcaa
actactagggtaaatgttctgaattcaaagacctcatcaaagatcacaatcaaagatgcc
accaaagatgatgttggaaaatatgagatcactttgactaattcaattggcacaaagaca
gctgaaatttcagtaataattctggataaaccaggttcacccagcaacattagggcggac
gaggtgagtgccgactttatctccctgtcctgggatgctccaacctatgatggtgggtgc
cagattaacaactatgttgtggagaagagagacactacctctaccacatggcaaattgtc
tcagctacagtagccaggacatccataaaggtttcccgtctcactcagggcacagagtac
caattccgcattgcagctgaaaaccgttatggcaagagtccagcaattgattctgctcct
gttgttgcacaatatccatttgagcctcctggccctccaaccaatcttcatgttgcccat
gccaccaagacaggcatgcttgtagtctggggcagacctgccaatgatggtggaagccct
gtcattggttatcatgttgaatccaaagaccaaagcagcattttgtggaccaaagtcagt
agaggtctgctgactgaaaaccaatttaagatgacaggcatcgaagaaggcctgtcatac
cagtttagagtctatgctgagaatattgctggcattggtccatgcactaaatcttgtgaa
ccagttgcagccagggacccatgtgaatctccacataaccttaaagtcacaaatatcacc
agaaactccgtttctctcttctgggatccacctgaatatgatggtggagtgaaaattgtt
ggatacatagtggagtgcaaagagctccctaatggtcgctggctaaagtgtaacttcacc
aatctacaggagacttactttgatgtcacaggtcttacagaagatgcacaatatgacttc
catgttattgcaaagaattctgcagagatgttgagtgccccttcagaatgcactggtcct
gtcaccatcaaagatgatgtagaacctccaaccatcatcttagaggataaattcaggcaa
ttagttgtcattaaggctggagagataattagaattgatgctgaaattacaggtcgtcca
atccctgtggtttcatggtctaaagatggaaaagatattgaggccaaggccaggtgtgaa
atcacttccacaaactttaccactactctgattgtcagagatgctatcaggagggattct
ggacagtatgtcttgactttgcacaatgtagctggaaccaggtctgtagctatcaactgt
aaggttctggacaggcctggaccagcttcaggacctttagcagtgtctggtcttactgca
gagaagtgcactataacatggggtccacctcaagagaatggtggagctgaaatcatgcac
tatatagtggagaaacgtgagacaagccgccttgcttggactcttgtttatggtgacatg
aaggcaactacctgcaaagttactaagctgctcaaaggaaatgagtacatcttcagggtc
agaggcgttaacaaatatggagatggtgaggctctggagagtgaggcagcaaaagcgttg
gatccgttcactgtagctgcagcccccactaatgttcaggtcacctcagtcactagtgag
gccatgacaatctgttgggaaagaccagtttctgatggtggcagcagtatctatggctat
gtaattgaaaagcgagagaagactggcctccgctggtgccgtgtcaataagaagcctgtc
tatgacctcagagtcaaagcttccaatcttcgtgagggaagtgaatatgagtacagagtg
tttgcagagaatgctgctggacttagtgcacctagcaccccttgcccactcaccaaggct
gaagacccacagttcctcccctcacctcctgctaagcccaggatcattgactcaacaaag
accacagtaacactagcatggaataaaccactgtttgatggtggagcacctgtaactggt
tacagagtagaatacagaaagtcattagatgatgaatggttcgttggagtccagaacacc
aagaatacagagtttacagtggtgggactgactcctggagctgaatatgtatttgttgtc
agatccattaataaaattggagcaagtgagcctagtcctgaatcagacaaacagactgct
aaagaaaaagaagaagagccagtctttgaaataagcaatgaaatgaggaagactcttatt
gtgaaagacggcagctcatttacaatgacggtacccttcagaggcaagcctattcccact
gttagttggacaaagcctgatattgatcttagagtacgtgctgtcattgacaccacagac
accttcacctcaatcaccttagagaaagcaacacgcaatgactctggaaaatacactgtc
actttgtccagcattgctggaacctcctcactgacactcaatgttagagttcttgactca
cctggacctcctgcatatgtggaagtcaaggaagtgactaaggcatctgctactgtaact
tgggacactccagagaatgaaggaggaggaccagtaaagaattatcttgttgatttccga
gaggcaagcaaaaaaggttggactaggttgactgatacatgccacagactgacttataag
gtgtcaaacctaaaggaaggagaagtttactatttcagagtgacaggcgagaatgactat
ggtgttggtgttccagctgagaccaaagagggaaccaagatcacagaaaaaccaagccca
ccaccaaagcttggagtaactgatgtcaccagggagagtgtgtcattggcatgggctaaa
cctgaacatgatggaggcagcagaattactggatatctggttgaagcactggagaagggt
caggagaagtgggttaaatgtggtgtcaccaagtttatccactttactgtgtctggccta
agggagaaagctgaatactacttcagggtcaaagctgagaaccttgctggatatagtgat
gttaaggaaatgttcacccctgttatggtcaaagaccagctggaatctcccgaaatcaac
atgaaggacttcccccacaacactgtgtacgttagagctggttcaactctgaagtgtgag
attcctctgactggcagacccctgcccaaagtcactctttccaaggataatgtagtactt
aagtcaacaatgaggttcaattctgaagtcactcctgacagcatcaaaatcatcttgcgt
gaaagcattgctggagactcgggacgctatgatataactgcctccaactccagtggaacc
accaagtcctttgtcaatattgtggttctggatcgcccaagtgttccacttggacctgta
gagctgtttgatgtcacagaagagagtgcaagtctcaggtggctcccaccagcatatgat
ggtggcagccccatcactaactatatcatccagaagagagaaacaactacagcaaactgg
attgacgtctcatctgctgtggctcgttgcaccataaaggttatgaaacttaccactggg
ctggagtatcagttcagaatcagggctgagaacaaatatggaattagtgaacatatcgac
tctccagcagtcacagtcagccttccatacactattccagatgctccatcaactccagag
gttactgctgtaaccagggagagcatcgcattagcctggaaggagcccaagtcagatgga
ggcagccatgtgtttggctaccatctccagatgaaagataggaacagcatcatgtggcag
ctagttaacaaaacggtgatccgatctacacactataaggtcaccaccgttaatgctgga
cttatttatgaatttaaggtggcagcggagaatgctgctggcctcagtgttttcagtaag
gcttcagatgctgtgttggctatagatgcctgtgagccacccatcaacctaagaatcagt
gacatcaccaaaaactctatcagccttgcctgggagaaacccaactatgatggtggatcc
cctattactggttacattgttgagaagaggaaaggtgttagtcctaagtggtccaaagct
aacctcaccaatatcacggacacacatttcactgtggctggacttacccagaatgaaaca
tatgaattcagggtcatggccaagaatgcagttggttcagtaagcaacccatctatgaca
gttggaccagccacttgtgtggacacctatggtgccccagaaattgaaattccccaggag
taccttaatgaggtcaaatacagcgcaggctcagacgtggaacttaaattcaatatcaca
gccaaacctacccccacaattgagtggtttaaggatggacgagagctcaaacctactgct
cagctcactttcaaacacacgtttgagtccactggtatattcctgagggacactactcgt
ctgaactcggggacgtatgaggtcaaagtgaagaactccctgggatcttcatgtgccatt
gtcaggctgctcattcaagacaagccaggacctcctgctggcgaaattcagtttaagaaa
gtgatggctgacaacattaccatcatgtggtctccacctgccgatgagggcggtgccatg
gtaactcattacatcgtagagaagagagagaccagcagagtcatgtggtctattgtgtct
gagaaacttgtagactgcatcgtgaatgtgcccagactcatccagggtaatgagtacatc
ttcagagtccgtggagtcaacaaatatggcattggagaccccctggagtctcagcccatt
attgcaaagaacccgtttgttcctcccagtgaaccatctaagcctaaggttactatgatc
accaagtccacaatgactgtgatctgggaaagacctgcactggatggaggcagtgatatt
gatggttattacctcgagaaaagagagaagaagagtcttcagtggttcaaggtggtgaaa
ggaacaatcagagacaccagacagaaagtcagcaacttaactgaaaacaatgagtaccag
ttcagagtttgtgctgtaaacaaggctggagcaggaaactactctgaagcctctgatctt
tacagggcctatgaccccattgatctgcctggtgaacccacaaagctccgtgtggtcgac
tccacaaagacttccatcactcttggctgggagaagcctgtctatgatggtggcagtgaa
atcacacactatttgctggaacagatgaatgcaggagagaaagaatgggttatcaccaac
ccacaggttaagggttgcgagtatgtggtgtcccacttgaaacctgccacttactacttt
ttcagagtatctgctgtgaacagcaagggcaaaggagaggacatcaagatgtaccagcct
gtgcaagccaaagacatattagaggaggctgatttggacttagatgttcctatgacaact
caatacacagctaaagccggccgcgatgttgaagtgtttatcccattgaagggacgacca
gctcccaatgtcacctggcgacgtggtgatcgtaacatggctggtgataaccgcttcacc
atcaagagcactgagagatccaccacactccttattccaaaggtcactcgtgatgactgt
ggaaagtacatgctggaaatagagaatggtgtaggtgaacccaagataatcaccgtttcc
ctcagggttctagatagtccatcatcctgccagaagctaataatcaaaaacgtgacaaga
gggaagctgaccctaagctgggaggctcctcttgttgatggtggctcacctgtcacaaat
tacattgttgagaagaaagcctcaaccatgaaggcctaccaggtgatcagtgcagaatgt
cctaacacatcttacaaggtgaccgacctggaagaggatattgcttacttctttcgtgtg
tcagctgaaaatgagtttggtgtgggtgacttctgtgagtccactgaagctgtcagagca
acagagactcctggagctgttaaaaacctggtgatgttggactctacaaagacctctgtt
acactgcagtggacccgaccggaccatgatggaggcagccacatcacagagtacattgtt
gaaaagagaagccaggatgaagtcaactggagtttaggtgcaacatgcaaacgttgtaca
tgtgaggtgactggactcagggaaaatgccatcatggatttcaaagtgtttgccaagaac
gagaaaggaagaagtgatttctctctgattggttcaatcccagtgatagattttattatt
cctccagaagccagtctcagtgattatccaaatggagagcttgctgttcgtattgggcaa
aacatccacattgagctaccatttaagggaaaaccaagacctgcaatcagctggctaaag
gataaccttccactaaaggagagcgagaagattcgatttaggaccactgacaacaagact
gcagtcacagttagaggagccaagaaggagaatgctggccagtacactttagttctggac
aacagagtggtcaaaaactactttgacatcaatgtaatcactcttggaccacctacggct
cctgttggtcctattcgctttgatgagataaaggctcaaagtatcatcatttcctgggat
gtgccaaaggaggatggcggtggtgagattacatgctacagcgtggagaaacgtgaaacc
tcccaggccaactggaaaatggtctgctcaagtgttgtaaggaccagcttcaagatccct
aacctagtcaagggagctcaataccaattcagagtccgtgccgagaacaagtatggagtc
agcgaaccactctgctcctcacatgttattgctcagcaccagtataaacctccaggtcca
ccaggaaagccagttgccttcaacgtcaccagtgatggtatgaccattaagtgggatgct
ccaggctttgatggaggttctcctatcgtgggttatcatgttgagaagaaggacaggaac
agcctcttatggcagaaggtcaattccacaatcatttccaacaaagagtacaggatcatt
ggtctcatggaaggtctggagtactctttcagagtttatgctgaaaacaatgctggacta
agccctgtcagcgagcagagcaaacatgctcttgccatatcccctgttgacccacctggc
actcctgtctgcattgatacaacaagggattcagtcaccctgcaatgggaagttccaaag
agagatggtggaagcaaaattgtggcttacaatgtagaaaggcgccaaggcagaggaaaa
tggctacgatgcaactttattgatataagtgatacccagttcactgtgactggtctgtcc
cctggagacagatttgagttcagagtgattgcaagaaatgctatcggtacagtcagcccc
ccatctaactcttctggatatatcatgaccaaggatgagagcattactcctgaaatcgag
tggtcccctgaccaggtgctcactctgaaggctggagaaaatgttaagctcaattgtacc
atcactgggcgcccagttcctcaggttttgtggtacaaggatggcaaagaaattgataag
cgaacaatgattgacattgagattaccactggcattggcaccagcagtctgtttatccgt
gatgcagacaggaaccaccgtggaatttatactgtggaagcaaaaaatagctctggctct
aggaaagcagatgttaatgtcagagtgcaagatactcctggacctgttgagggtcccatc
cgctttaccggcataactgctgaaaagtgcactgtatggtggaacccaccagaaaatgat
ggctgtgctgcgatcacccactatgtagtggaaaaacgggaaacatccagaatttcctgg
gctttggttacatccaaatgtgaagcttgctcatataatgtcaccaacctcatcaaggga
aatgagtaccagttcagaatctctgcagtcaacaaatttggggtcggcaaaccactggat
tctgatgcagttattgcacgcatgcaatacactgtgccagatgctcctggtacgccagat
gcaactcacataactggagatagcatcactatgtgctggaccaggccgagatcagatgga
ggtaatgaaatcaagcattacattctggaaaggagagagaagaagagccttcgttgggtt
agggtgtcttccaagagacccataacagaactaaggcaccgtatcacccacctgaccgag
ggcaatgagtacgagttccgcgtcatggctgaaaatggagctggtattggaccagccagc
agtacctccaggctctttaaatgcagagagccaacaagtgctcctagtgccccaagtgta
atcaaggtcattgactccactaagtccactgtcaccctggaatggacaaaaccagtattt
gatggtggcttggaaattattggctataacattgacatgtgtaaggccagtctagaggag
tggcacagagtcaatagtcagatttgtatccacaatagatacactgcaaagggcctggta
gctggagagctttacaagttcagagtcagtgctgtgaatgggtcaggagagggtgaagct
tcagttatgccacaccctgttcaggctctagatagacttacatctccagaatttgacatt
gatgcaaacttcaaacaaactcacactgtcaagaacggaggaatagtcactctcagcgtc
gctttcagaggaaagcctactccactggccacctggtctagagtagatggtgaagttcct
gtcatggcggacatcaacaccacagacagctcatccactctgactatagaaggctgcaca
agatatgaggcaggaaaatacaccctgtccctggaaaacaacagtggacgaaagtctatc
acattcactatcaaagttttagacactccaggacctccaggagcaatctccttcaaagat
gttacacgtggtgctttgacaatgatgtgggatgctccatccaatgatggtggagcccgc
atccatcactacatagtagataaacgtgaggcaagccgccttgcttggcaggaggtcagc
agcaagagctcacgccaaatgataaggataactggtctagacattggtgtgccatactta
ttcagagtgactgctgttaaccagtatggtcaaggtgaaccaaaggaaatgactgagcct
gtcgttgccacagaagagcctgcaccacccaaaagattagatgttgtcgataccactagt
tccacagcctccctagtgtggcttaaacctgaccatgatggaggcagccgcatccgaggg
tacattgttgaattcagagccaagggtagtgaccgttggattgtttatggagagactaaa
ttgccgaagatgctggtagaaggtctgattgaaaacactgagtatgactttagggtcaag
gccaaaaatgatgctggaatcagtgagcctcaaggcactttcacctctgtgatcataaag
gagcctctcattgagccaactgctgatctcagcagtatcactaaccagctcatcacctgt
aagctttccaatactatcacaattgatatcccaataagcggcagacctgcgcccaaggtc
acatggaaactggaggaaatgaagctgaaggagactgacagagtcttaatcaggaccaca
aatgagagaaccacactaatagtgagagacagcaagagaagtgacagcggcaagtattac
ctgatcctggagaatgctgctggtgtgatgactttcacagtgactgtggtcgtcgtcggc
agacctagcccaccaactggccctgtgaagatttctggaatctcatcagagtcttgcaca
ctgtcatggtcagagccagctgatgatggcggcactgaagtaaccaactacattgttgag
aaacgcgagtctggccatgcttcatggcaggtagtaaactccagtgtgcagagaacgaca
atcaaagtgactcatcttaccaaatacatggaatacacattcagagtgtgtgccgagaac
aagtttggagtcagcaagtccattgagtctgcagctgtcgtgatcgagcatccattcatt
cctccaagtcctccaactcgccctgatgtggtatttgtgtcagcaaatgccattggcatt
aagtgggatgtgccatattctgatggtggcagccaggtgacaggatactggattgagaag
aaagagaggaacacaatcttgtgggtgagggaaaacaagctgccctgccttgagtgccat
tacaaggtgtccaacctgatcgagggcctggagtatcagttcagagtgtacgccatgaac
ctcgctggactgagcaaggccagtgaagcctccagaccagtggtggccctcaatcctgtt
gatccgcctggtaaacctgagattaccgacatcagccgctcctctgtttcgctgtgctgg
actgtacccttcaacgatggtggcaataagatcgtcggctacattgtggagaggaaggtc
tacagcacagatgagtgggacgacaaccgctggctcaagtgcaactacaccacgatcaca
gagaactacttcacagtcacaaacttgggagagggagaaacctttgagtatcgtgtcatc
gccaagaatgcagctggagtccacagcatgccttctgtgaccactggtccaatcacatgc
aaggatgaatactctcctcctagagctgaacttgacagcaaattaacgcgtgaggtcatc
accattatggctggctccgaccttgtcctggatggtgctgtgggaggcaaaccagaaccc
acagtgtactggtccaagggagacaagattttggatttgggagagaaatactctctgaca
tacacgtcaacaagagccatggctgtcatcaaaaactgcgacagatacgatacgggtaga
tacatcctcaccgtcaaaaacgccaatggtattaagaccgcttcagtcagtgtgaaggtt
ctggacactcctggacaacctgctgacaagattgtgatcagcagagtcactgaggagaag
tgtacggtttcctggaagattcctctggaggatggcggagacatcgtcacccattacatt
gtagagcgacgtgaaaccagccggctcaactgggtcatcatggagacagagtgcaagtcg
ctgtcatgtgtcagctccaggttgatcaagaacaatgaatacgtcttcagagtcagagga
gtcaacaagtttggacctggagttcctctggagtccgagccggtcatcgccagaaacgcc
tacactgtcccatccccgccgggcgccccagaggccacagcagtgggtaaggagcacatc
atcatcgagtggctgaagcctgagagcgacggaggcagtgagatcaagaactacatcgtg
gaaaaacgagagaaaagcagcacaagatggactcgggtgaacagaacttacacaatttat
gacatccgtctgaaaatcactggcctgatagagggaggcgagtaccagttcagagtcacg
gctgtcaacaatgctggagagagccagccaagcgatgcctcgccatacattatctgtaaa
gatcccacatacacaccggctgctccatcaacacctcgcatagtggacacaaccaagcac
agcattagcttgacctggaccaggcccatgtatgacggcggctccgatgtcacaggctac
gtcatagagatcttagaggaggactcggagcagtggtaccgcgccactgctaagcctata
aagaccaatgagtacgtggccggtggcctggcagccaataagaagtacaggttcagggtg
gcggccattaatggcaacggcaccggggagttcagtgacccgagtggagagatcgagcca
ctggagaaaattgaaatgcctgacctggaactggcagaagatttgaagaagacggtttgt
ctgcgtgctggcggtaccctccgcctgttcgtgtccatcaccggccgaccggcacctgtt
gttgcctggagaaagaccggtgtggagctgcagagccgaggcttcattgagaccaccgac
agtcacacctctctcctggtggagaaagttactcgctatgattctggaaaatatgttgtg
gaggcagagaatccatctggaaagaagacgtgcattatcctggtcaaggtctacgacact
cctggtcctcctggttctgtcagggtgaaagactacaccaaagagtcggttgtgatcacc
tgggacgtcccaagcctggacggtggagctcatgtcagcaactacatcgtcgagaagaga
gaagccaacatgaagtcatacaagactgtgaccactgagtgcaggaagactctgtacagg
atcacaggcttggaggaagggatgcactacttcttcagagtcctacctgagaacatttat
ggtgttggcgagccttgtgagacagctgagtctgtgctggtgtgtgaagtaccatcagtg
cccatggacctcagcattgtggatgtcaccaagtccactgtgaccctccattgggaaaga
ccacatcatgatggcggcagcaggctgacaggttacatcatagaggcttgcaaggtgggg
tcagacaggtggagtgccgtggcgacagttaaggcctctcagtcccagcacacaatccag
tcgcttacagagaacgaccagtacctgttcaggatccgtgccaccaacagcaggggggtc
agtgaacccatggacattgtgacaccagtcataatccaggatatcaaggtgatgccaaag
attgacttgaccagcatccctcagaagatcgttcatgtgcaccgtggcaaatccattgac
ctgaacatcccaattaaagccaaaccactgccggtttgctcctggtacttcggtggtgcc
aagctgaaggacagcttggaccgcatcaagatcgacagcaacgggaaatacacacacctc
gtcatccgtgactccaccatcgatgacactggagattacactttggaggtgaaaaatgct
attggcatggcaacggaggttatcaaggtcatcatcctggacaaacctggtatcccagtt
ggtcccatgaaaatcgaggaggttgatggagtctcggtaacagttagctgggaacctcca
gagaaagacggtggtgccaatgtcagtggctacgtggtggagcagcgtgaagcccaccac
ccaggctggtccaccatctctgaatctgtgaccagaccttgcttcaagttcaccaggctt
aacgaaggaactgaatatgtgttccgtgttgctgccatgaatcgctttggttttggtggc
ttcctgcagtctgaagtggtggagtgcaagagcgccaagaccatccccggacctccaagc
aggccagaggtgattgatgtcacccatgaaggcatgaccgtgacctggcaaccacctgtg
gacaacggtggctccaccattgctggctacataatagaacgtaaagaggcccgatctgac
agatggttgagaatcaataagaatccggtcactatgaccagatatcgttcttccgggctg
attgagggcctggaatatgagttcagaatcactgctatcaactccagaggaactggtaaa
cccagtgaaagttctgcagtagctgttgccatggatcccattgaacctccaggtcctcca
gttaaacccagagtcacagacagcacacggacatcagtctctctggcctggctgccgcct
gaagaagagggtggttctgttgttactggctatctcattgagatgcaaaaggtggaccag
gttgaatggactctgtgtaatactacacccaccaagatgtgcgagtacaccctaacacac
atgccccagggtgcagagtacaggttcagagtcattgcctgcaatgcaggtggtgccgga
gagcctgcagagatttctggagtggttaaagtccaagaaatgattgattatcctgacttt
gagcttgatcgtgtatacgaggaaggatacgtggtgcggcaaggtggagtcgtccatttg
tctgtacccatcaaaggcaaacctatacccacagctaagtggacaaaggatggtcgtgac
atctcacatcgtgccatgattgccacccacgatgacatcactgagctggtcatcaaagag
gcacacagagacgacaccggtacctatgatttggtgctggagaacaaatgtggtaggaaa
gctgtgtacatcaaggtgaaggtgattggtcgacctgatgccccagaaggtcctctagaa
tttgatgacatccaggctagatcagttcgcgtcagctggagaccaccttcagatgacggt
ggatctgacatcctgggctacatagtagaaaggcgggaagtaccaaaggctgcctggtac
acagtggatgcccgggtaactgagacctccctggtggtcaagggcttgaaggagaatgta
gagtaccacttcagggtgtttgctgagaaccagtttggtgttagcagatcccttaagtca
gatggaactgttctgccaaagacacctctttgtccacctgaacctcccagtaatccacca
gagatcatggacatcaccaagaccgcagtgtctctgtcttgggcccggccccgggacgat
ggtggctctcgtgtcacaggatactatgttgaaagaagggaggtttccacagagaagtgg
gtccgtcacaacaagacccacatcactaccaccatgttcaatgtcaccggacttataccc
aacgcagagtacatgtttagagtggtggctcaaaatgacattgggcagagtgaacctggt
cctgcttcagaatcggtggtctgcaaagatccatttgacaagcccacccaaccaggagat
attgacatcatctctattactaaagacagtatcaccattcattggctcaggccagaacat
gatggtggaaaggagatcctgggttattggattgagttcagggaggctggagagagtgct
tggaagaaatgcaacaaggagcgttccaaggatcggcagttcaccatgggtggcttgatg
gaggccacagagtatgaattcagaatctttgctgaaaatgaggccggactcagccgacct
cgtcgcacacccatgggcatcaagaccaaattgagcgttggtgaagctccagctttgaag
gaagaggcccaagatgtaaccaccaagcttggcgagtctggcactctaacttgtggaatc
attggcagacctttgcctgagatcaagtggtatcgctacggcaaagaactgatccagagc
cgcaagtacaagatgagctcagatggtcgtaaccactccctcacaattctgacagaggag
caagaagacgaaggcgtgtacacctgcagggctgtcaacgaggctggagagatagagacc
agtggcaaactacgcttgcaggcagctccccaattccaccctggcttccctctgaaagaa
aagtactatgctggggctggtaccagcctccggctccatgtcgtctacattggtcgtcca
atcccccagataatgtggttctacggcaagaaacctctaaattcatctgagaacgtgatc
attgaaaacacagaaagctatacccaccttgttgtgaggaatgcccagcgaaaaaccaac
gctggtcgctacaaggttcagctcagcaatgtgtttggaactgttgacacctctctgcgt
gttgaaatccaagacaaaccttgcatccctgagggtcccgttgttgttgaatccctgctc
aggaactcagttgtgatcagctggaaggttcctaaggatgatggagggtctgtaatcacc
aactacattgtagagaaacatgaagccaaagagggtgaacagtggcacctggtgtcttcc
tctgtccctggcaccacctgccgtgtccccaacctgactgagggctctggatactacttc
agagtctcagcacagaaccagtatggtgtcagtgagcctctggagattccatcagtagtc
atcatcaagtctccatatgataaacctggaatcccacagcagccattcattatcagttct
accaaagactcttgtgtcgtttgctggaagcctccaactagcgatggaggagcgaaaatc
accagctacttccttgagaaacgcgagaagaagcagaacaaatggatgtctgtaacaaca
aagacatttacagagaccagctatgaagtcacgggcttgattgagagctttgagtacgag
ttccgtgtgaaatgccagaacattggcggtgagagcgactggtctgagatctctctgcca
gtcattcccaagtctgaacaggctcctcgtgctcctgcattcagagaggagatcagagac
atgacggtcaaataccatagcaatgccacctttgtcaccaaggttgtggcccatccaaag
cctgttgtcaaatggtatcgcagtggcaaggagatcctggcagatggaacaaaaataaaa
gtccttgagttcaagggtggctactatcagctggtcatcactgccgctgatgagaacgat
gcctcagtgtaccaagttagagcaactaacccgtcaggatctatctctacaacagccaac
ctggaggtggaagttcctgcaaaaatacacctgcctaaagaactccagggaatgggagct
gtacaagctgtgcgtggtgatcacgtcaccatcaagatccccatcacaggaaagcctgag
ccagcagtcacttggcagaagggtccggaggtcctctcaagctctgcttatcatcaagtt
atcactacaagatccttcacctccctggtgttcctgaagggagtacagaggaaggatact
ggctattatgccattactgcaaagaacagattcggatcagacaagcaaactattgaggtg
aatgtggctgacatccccgatgctccaaagggacttgtggtcagtgacattgcacgggat
tctatcacgctgacctgggagccccctgccagtgatggtggcagtgagattattaattac
attgtagagaagtgcccaaccactgctgataggtggattcgtgctggccatacaacagac
tgcagtatcaccatcatcaacatatttggaaagaccaaatatcagttccgcgttattgca
gagaaccagtttggtctcagccttccatctcctccaactgagcccattactaccaaggaa
gacaaatctgtgatcaggaactatgacgaggaagtggatgaagacagagaaatcaccaaa
gaggaagctgtgttctacaaggtgaaggaactgtcttccaaatacatcatctcagaggag
cttgctcgctcccagtttggagtggtccaccgctgtgtggagattgccactaagaagact
ttcatggccaagttcatcaaagtgaaaggaactgatcgtgagttagtcctcagggaaata
gaggctcttaatgttgcaagacataagaatatcatctacctccatgaatactttgaaagc
atggaggagattatcctgatctttgaattcatctctggagttgatatctttgagcggctt
ggtaccagcaactttgagctctcggaacaggagattgtccgctacctgagacaggtttgc
tctgctgtcaagttcttacacagccaaaactttggccactttgatatccgcccagataac
attgtttacgccacaaggagaagtctcaacataaaaatgattgaaatgggacagtctcga
ctgttggttcctggagaaaacatcagaatgctgttttcagctccagagtattatgcccca
gaggttcaccgccatgatctggtcaccacagccactgatatgtggtctattggtgttttg
gcatatgttctactcagcggccttaatccatttgccgcagaatctatgacaaagatgatt
gagaacatctcaaactgtgagtacgtttttgacagggaagcattcaaagacatcagctta
gaggcaatggactttatagatagacttctagtcaaggacaggaagctccgtatgacttct
catgaagctctagaacatccatggctcaagatgaagattgagcatgtcagcaacaaggtc
atcaggacactgagacacagaagatactatcagtcactagtaaagaagactgataccata
gtttcagcagctcgtgtggcgttcggaggtgccttcagaaaccagcgaggtctggaagtt
ggtaaagttaagattggaaccgagtaccatgggttgcgtgctgggcctgtcatgcatgcc
tcagctgaggaaggtggccatgtcagatttacctgtagtattgtgaactttgacaagagt
actcaggtatcatggtacttaggtaaccgtcagttacatccaagccccaagtatgagatt
tcctacagtaatggctttgccagtatttacgtgaaggacattgaagaatctgatgatggt
gtctacagatgcaaggtggtgagtgatgatggagaggacagtgcctatggagaactcttt
gtagaaactctgaggagcatcagagagcactacatgagccgcaccatcaggaagctgagg
aggagggttgacaaaactaaacttctccagagaccacctgagttcactttgccactctac
aaccgcacagcatatattggtgaggatgtgcgctttggtgtcaccatcactgtgcaccca
gagcctcatgtaacctggcttaaaaatggagaacaaatcaaagaggatgacagcaagtac
accttcacaagtgacaagggcctgtatcaactcatgattcacaaccttgacattggtgat
gatgctgaatacacagtcatggcccacaacaggtttggagaagacagctgcaaggctcgt
ctcactgtgatacctcatcctgtgcttgaggatacaatgaagcccatgttcaaacgtcta
ctggctaatgttgagtgcacagagggagacagtgtccgctttgaactcagggtgtcagga
gttcccactccttctcttaaatgggaaaaagatggccttcctctacagtttggtcccaaa
gttgttgtcatagagcaggacattgattatcatgtccttcacatcagggagactctgctt
gaggatgatggagtgtacaaagtcacagcaaccaactctgctggctgtgcaagctgccag
gccactctgaaagtggaccgtctcacttacactagaagagagtacaagagcgaagaggag
aaactcagacatgtacagaaacaaatagagaagaccaacaaaatggctcagcacattgca
gctacagaggaacttgtacctctaaacccaacagcacaggaggccctcaaatttgctgca
gaggtctacaaacccgcagtaagcaccaagaacattgaaggcgaatttgacatcacagag
gagaagacagagaccaagaagctagaggaagagagaaggattttcatgccctatgaaatt
cctgagcctgtggttcatgatcctaaagctctggatgaagacaaagccattaagcagttt
atacctctgtctgacatgaagtggtatcgcaagatacgagatcagtatgaggtatcagag
agaacagaaaggattgtgcaaaagaggcagagacgtattcgtctgtccaggtgggagcag
ttctacgtgatgcctctccccagaatcactgaccaatacagaccaagatggcgcattccc
aaattgacaatggatgatttggagactgttagacctgcccgacgttcaccatctcctgag
tctgaagtctcttttagatccagaaggaggtctctgggagatctcagtgatgaagagctg
ctgatgcctgtggatgactacctgacaaggaagagagctgaggaggaaacaatgatgctg
gaagatgaacttgagctcggtttttctgcctctcctcctggtagccccattcgagttcaa
cgacgtgtcgttgaacatgaggaaaggaggcagggagtcagacatgaggccgctgaggtt
gtagagacaaagaagaaacgtactatttctcagtacacaagaaggagaaggtcactgtct
cctacctacattgagctgatgcgaccagtctcagagctaatccgaccgccacatgctaga
cctgtggaaacagagggagagattgtggggaggagatcccctactccagagaggacccgt
cctcgttctcccagtcctattaggtcagtggagaggtcttcccgctcctcctctaggttt
gagcgttcggcacgctttgacatcatgtcccgttatgaagccaggaaagctgctctgaag
tctgagaggaaataccaggttgtgagtcaagcacctttcagccttgatcatgctcctcgt
gtaactgtcaggatgcgctctcatcgcatcccaactggtcaggacacaaaattcaccctg
aacatccaagcaaaaccagacgctgaagttgcatggttccacaatggagcggaaatctct
gaacatggtgagaaatacatcttcacaaacatgagtggcgttctgaccatcactatcctg
gactgccaagaagaagacagcggaacataccgctgtgtgtgctccaattcaaagggtgag
gcatctgactacgccaccctggaggtgtcaggaggcggatatactacattctcctcccgc
cgcaaggatgaggaagctcctaaagcattggtccctgaagtcacacgcattgatcactat
cacactacgcactttaaatctggctatacctctcaaacctacctggaggtggaagagagc
aagtcaaagctaacagaaacacgtgaggttgtcacacgggaaagaattggtacctcggcc
gagagattctcttctggtgagcgattctcttctgctgagaggtatgactcatctatcaag
tatgcctccactgaatatctttcttctagttcctcatattcttcagagaagttttcttta
actggaaagcatgcaacttctgaagataaactgaaaacatcctctactgcttctgctctt
gagcaactttcgttgcccaaggagaaatcttctcttcctgccaaaatcctcaccaagcca
cagtctgtgactgttgcagagggagagacagcccggttctcttgtgacatcgatggggaa
cctgcaccaactgtgacatggatacacgacagcaaaacaattgtatcatctcttcgtatc
catgtcaccacaactcagtacaagtccagcctagagatttcatctgtgaccatatctgat
gagggcagttacactgtggtcgtcgagaactcagcaggtagacaggaggctcatttcact
ctgacaatccgcaggccacctccaaaggaggaaaccaaagctgtcaaaactactgagcca
cctgtgaagtcaccagcacccagtgttaagtcacctgagccctcagctgcatcccctgct
ccttcctcagcacctagtataaagtcaccagaaccaagtgtaaagtcaccagctgtagca
tctcctgcacccgaagttaagtcacccacaccaagtgtaaagtctcctgaaccagaggaa
gcaaaatctgttaagagcatcaaatctccggagccatcagcaccctctccagcacgcagc
ttaaaatcaccaactcctggtgtaaaatctcctgaaccagaaggaatcaagtcaccacgt
gggctaaaatctccagaacccagactaaagtcaccaccaccagtcaaaactcctggaggt
gtgaagtcaccagaacctgaagaggcaaaatctccccgtggtgttaaatcaccagaacct
gcaggtatcaaaacaccaagaggtctcaagtcaccagaacccgcaggaatcaaaacacca
agaggcatcaagtctccagaacctccaggtatcaaatcgccaaggggattgaagtcacct
gagcctgagggaatcaaatcacctccgagagtaaaatcacctcctccaattatgtccccc
aagagggtcgtgtctcctcccactgtgaaatccccgacccctaaacctcccaaagtcctc
agccagctaacagctgaggcctgcgagggttcagtcaacctgtcctgcgtctgtgaaagc
agcgtcagggaggtggtgtggtacgttagcggcaggaggctttcacagagcagccgcttt
gagatgcactactctgaaggatcctgcaatcttctgatccatgagctggcagagagtgac
cagggagagtacacctgtgagatgatttcagatggaggcgtgtccaaatcctccttctcc
ttcagtggtcaggtgtttcagtccatatacaagaaagtcacagcttaccgagagcagcaa
gtggcgcttaaagggtcaatgatggttagtcaccaggagtcatcaaaggcctcgtccatg
atgacaaagaaagaaattcacacgatggaggagtcttcggccttttcctcctctgcccac
cagacaatgatgtcatccatgatggagtccagctccttcagcagcatggcagctgagatg
aagtttgagaccatgtcaatgtccagcatgtcctccatgacatctgagacgtacgccatg
agctccagcagtctcacagaaatgacatcccacatggagggaacctcaatgagagcaatc
ggttctgctccgagaatcgaagctttgccagaggacatcagcatcgaacctggcaaagtc
ctgacggtcgcttgtgcgttctccggcgacaccaagcacatagagtggtcccgctcaggc
aagacgatcgacttgtccacgggtggacgattccacatcgagaccacggaggacctgacc
accctcatcatcacaggggtgaaggaggaggacgccggtgcctacaccctcagactgtcc
aatgagcttggatcggactcagcaaccgttcacatcagcattcgatcggtgtaa

DBGET integrated database retrieval system