KEGG   Xiphophorus maculatus (southern platyfish): 102219923
Entry
102219923         CDS       T02923                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00230  Purine metabolism
xma00240  Pyrimidine metabolism
xma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102219923 (dck)
   00240 Pyrimidine metabolism
    102219923 (dck)
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     102219923 (dck)
SSDB
Motif
Pfam: dNK AAA_33 AAA_18 Thymidylate_kin AAA_28 AAA_17
Other DBs
NCBI-GeneID: 102219923
NCBI-ProteinID: XP_005808658
Ensembl: ENSXMAG00000005412
UniProt: M3ZT88
Position
8
AA seq 263 aa
MPAIPKRPCPDPMNDSMEKRMTRISVEGNIAAGKSTFVRLLEQESTDWEVVPEPIARWCN
VQTTSSDFEELTTSQRSGGNVLKMMYEKPERWAYTFQSYACISRVRAQIKSANGKLREAE
NPVLFYERSIYSDRYIFAGNLYESECMNETEWSIYQDLHGWLHNQFGKHIELDGIIYLRA
SPEKCLERLHMRGREEEQEIPLEYLEKLHYKHESWLQNKTMNMDFEYLSDVPVLTLDVND
DFKQNDSKSADMIEKVKEFLSTL
NT seq 792 nt   +upstreamnt  +downstreamnt
atgcctgctataccgaagagaccttgccccgacccaatgaatgactccatggagaagaga
atgacgcgcatttcagtcgaaggaaacattgcggctggaaagtcaacttttgtgcgcctt
ttggagcaggagagcaccgactgggaggtagtaccagaaccgatcgctagatggtgcaat
gtccaaacaacaagcagcgactttgaggagctgaccacgtctcagaggagcggcggcaac
gtgttgaagatgatgtacgagaagcccgagaggtgggcttataccttccagagctacgcc
tgcatcagccgagtgcgcgcccagatcaaatctgcaaacgggaagctccgagaggctgag
aatcctgtgttgttctacgagagatccatctacagcgacaggtacatctttgcaggcaac
ctatacgagagtgaatgcatgaatgagactgaatggtccatctaccaggacttgcatggc
tggcttcacaaccagtttggcaagcacattgagctagatggtatcatttacctcagagct
tcaccagagaaatgcttggagcgattacacatgaggggaagagaggaggaacaggaaatc
cctctggaatacctggagaagctccactacaagcatgagagctggctgcagaataagacc
atgaacatggattttgagtatctcagcgacgttcccgttctgaccttggatgtaaacgac
gattttaagcaaaacgattcaaagagtgccgacatgattgagaaggtgaaggagttcttg
agcacattgtga

DBGET integrated database retrieval system