KEGG   Xiphophorus maculatus (southern platyfish): 102220081
Entry
102220081         CDS       T02923                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00230  Purine metabolism
xma00240  Pyrimidine metabolism
xma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102220081
   00240 Pyrimidine metabolism
    102220081
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     102220081
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_17 Thymidylate_kin AAA_28
Other DBs
NCBI-GeneID: 102220081
NCBI-ProteinID: XP_005803589
Ensembl: ENSXMAG00000006316
UniProt: M3ZVU0
Position
11
AA seq 261 aa
MATPPKRLRGAPTGSRRHRKISIEGNIAAGKSTFVRILQASSSDWEVIPEPIGKWCNVQS
DGDDVYQELSSSQKSGGNILQMLYDKPSRWAYTFQSYACLSRVRSQLQPPSAKLQQAENP
VQFYERSVYSDRYVFASNLFESGNLLDTEWSVYQDWHTWLLNQFEPDIALDAIIYLRAPP
QRCMQRLLHRGRQEEQGIPLEYLEQLHFKHEAWLYDRNLRLDFEYLSELPVLVLDVNEDF
HNDRIKQEDIVDKVREFLSTL
NT seq 786 nt   +upstreamnt  +downstreamnt
atggcgactcctccgaagcggctccgcggagctccgaccggctcccgcagacacaggaag
atctccatcgagggaaacatcgctgcaggtaaatccaccttcgtccgcatcctccaggct
tcttcctcggactgggaggtgatcccagaaccgatcgggaagtggtgcaacgttcagagc
gacggcgacgatgtctaccaggagctgagttcctcccagaagagtggagggaacatcctg
cagatgctgtacgacaagccgagccgctgggcctacaccttccagagctacgcctgcctc
agcagagtccggtctcagcttcagcctccatcagccaagctgcagcaggcggagaacccg
gttcagttctacgaacgctccgtctactcagacaggtacgtctttgcgtccaacctgttt
gagagcggcaacctgctggacacggagtggagcgtctaccaggactggcacacctggttg
ctgaaccagtttgaacccgatatcgctctggacgccatcatctacctgagagcccccccg
cagcgctgcatgcagcggctgctgcaccgcggccggcaggaggagcagggaatccctctg
gagtatctggagcagctgcacttcaaacacgaggcgtggctctacgacaggaacctccgg
ctggactttgagtacctcagtgaacttcctgttctggttctggatgtgaacgaagacttt
cacaacgatcggatcaaacaggaagacatcgttgataaggtcagggagtttctcagcaca
ctatga

DBGET integrated database retrieval system