KEGG   Xiphophorus maculatus (southern platyfish): 102220084Help
Entry
102220084         CDS       T02923                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II delta chain isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04012  ErbB signaling pathway
xma04020  Calcium signaling pathway
xma04114  Oocyte meiosis
xma04217  Necroptosis
xma04261  Adrenergic signaling in cardiomyocytes
xma04310  Wnt signaling pathway
xma04912  GnRH signaling pathway
xma04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102220084
   04310 Wnt signaling pathway
    102220084
   04020 Calcium signaling pathway
    102220084
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102220084
   04217 Necroptosis
    102220084
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102220084
   04916 Melanogenesis
    102220084
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102220084
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xma01001]
    102220084
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     102220084
Protein kinases [BR:xma01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   102220084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 Pkinase_fungal Kdo SnoaL_2
Motif
Other DBs
NCBI-GeneID: 102220084
NCBI-ProteinID: XP_023198810
Position
12
AA seq 683 aa AA seqDB search
MATTTCTRFTDEYQLYEELGKGAFSVVRRCVKLSTGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGFHYLLFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKCKNAAVKLADFGLAIEVQGDQQAWFGFAGTPGYL
SPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTV
TPEAKNLINQMLTINPAKRITAQEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKLK
GAILTTMLVSRNFSVGSRQTTAPASVTAAAAAVAAAAGTTAGLVEQAKTLLNKKADVKPQ
TNSTKNSIVTSPKGNIPSPALEPQTTVIHNPVDGTKESSDSSNTTVEDEDVKGKSLDNSS
LKAQSSTSSQPDSTQGSSAAVHSAAKFADLLGSVRRGSGPITDGEGRSSTPPPAALSAPS
PPHTPVVPMQMSRLTDLVSSVRRVPPPAAPDGDATSAPAPVTKPAPPPAHTTPPPPSHSP
SSPSLSSSQTRKQEIIKITEQLIEAINNGDFDAYAKICDPGLTSFEPEALGNLVEGMDFH
RFYFENLLAKNNKPIHTTILNPHVHLIGEDAACIAYIRLTQFVDNQGQPRSSQSEETRVW
HRRDSKWQNIHFHCSGAPAAPLQ
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggccacgacaacctgtacgcgattcacggacgagtatcagctgtacgaggagctgggg
aagggagcgttttcagtggtgcgcagatgtgtgaagctgtcaacagggcaggaatatgcc
gctaaaataatcaacaccaaaaagttgtctgcaagagatcaccagaagttggagcgagag
gctcggatctgtcgccttttgaaacaccccaacattgttcgtcttcacgacagtatatca
gaggagggtttccactacctcctgtttgacttggtgaccggaggtgaactgtttgaggac
atcgtagccagagagtactacagcgaggcggacgccagtcattgcatccagcagatcctg
gaggcggtgcttcactgccatcaaatgggcgtggtgcaccgggacctaaagccagagaac
ctgctcctcgcaagcaagtgtaagaatgctgcagtgaagcttgcagactttggcctggcc
atcgaggtgcagggggatcagcaggcctggtttgggtttgcaggaacaccaggatacctg
tcccccgaggtattgaggaaggaggcatatggcaaacctgtggacatctgggcctgcggg
gtgattctctacatcctgctggtgggttaccctcctttctgggacgaggaccagcacaag
ctgtaccagcagatcaaggctggggcttatgattttccatccccagagtgggatacagtc
accccagaggcgaaaaacctgatcaaccagatgcttacaatcaacccagccaagaggatc
actgctcaggaggctcttaagcacccatgggtctgccaacgatccactgtggcatctatg
atgcacagacaggagactgtggagtgcctgaagaaattcaatgccaggaggaaactcaag
ggggcaattcttacaaccatgctggtttcccgaaatttctcagtcggcagcaggcagacc
accgcgccagcctctgtgactgcggccgcggcagctgtggctgcagccgccggcaccacc
gcagggctggtggaacaagccaagaccttgctcaacaaaaaggcagatgttaagcctcag
acaaacagcaccaaaaacagcatagtcaccagtcccaaaggaaacatcccttcacctgct
ctggaacctcagacaactgtcatccataatccggtggacgggacaaaggagtcgtcagac
agcagcaacaccaccgtggaggacgaggatgtgaaaggaaagagcttagacaacagctca
cttaaggcgcagtccagcacaagttcccagcctgatagcactcagggctcctcagctgct
gtgcactctgctgcgaagtttgctgacctgctgggctctgtgcgtagaggctcagggccc
atcaccgacggagaaggtagatccagcactccgcctccagctgccctctccgccccttcc
cctccacacacccctgttgtccccatgcagatgtcccggctcacagacctggtaagcagc
gtccgcagggtgccgccgcccgctgcacccgacggcgacgccacctcggcgccggccccc
gtcaccaagccggcccctccacctgcacacaccactcccccacctccctcccactccccc
tccagcccctctttgtcctcatcccagacgcgcaaacaagaaatcatcaagatcaccgaa
cagctgatcgaggccatcaacaatggagactttgacgcttacgctaagatctgcgatcct
gggttgacttcgtttgagccggaggcgttgggaaacctggtagagggcatggatttccac
agattctactttgagaaccttttggctaagaacaacaagcccatccacaccaccatcctg
aacccccacgtccacctgatcggcgaggacgccgcctgcatcgcgtacatccggctcact
cagtttgtcgacaaccagggccagccgcgctccagccagtcggaggaaacgcgtgtctgg
catcgcagagacagcaagtggcagaacatccacttccactgctcaggcgcgccagctgcg
cctctccagtga

DBGET integrated database retrieval system