KEGG   Xiphophorus maculatus (southern platyfish): 102220451
Entry
102220451         CDS       T02923                                 

Gene name
ahrr
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
KEGG Orthology (KO) [BR:xma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xma03000]
    102220451 (ahrr)
Transcription factors [BR:xma03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102220451 (ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 102220451
NCBI-ProteinID: XP_005811536
Ensembl: ENSXMAG00000001996
UniProt: A0A3B5PQ51
Position
21
AA seq 682 aa
MIPPGDCMYAGRKRRKPVQKQKPSSANEKSNPSKRHRDRLNAELDRLASLLPFPPDVISK
LDKLSVLRLAVSYLRVKSFFQASQDKPSRKHVTTPASSNPEPRKDSLPLGTTINESSLLL
ESLTGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHIDDRQEFRRQLHWAMC
PPQHQAMSGEPDSQLAAGTSEDFVVSSMFNSPEAGEIPPELSCFLNRCFIARVRCLLDST
SGFLTMQFQGRLKFLHGQKKKSPSGTLVPAQLGLFCIAVPLLLPSITEMKVKNILMRGKN
KGGGIVSPMEHGESGEHLRRHSIGGGMGDMTDPLLFTCPHPGTTQRSHHALWSPLCKDNL
KCSSDSFYGQEEPLNFCKSSVADHKGAAAGLGGGWPMRQRAGPVRAAQGVSYIPSNRLNR
TGQYGKPYRLSPSCHGGRGADVYVSKLYGSSDADAYCVDLVKSENDFGECYEGHMMSEMP
PIKIEHDSDSENGCEMYGQTWACRNQATIDRHYGNGAYDPSTGLQLKSETDYYDLQYSPC
QRGKAGISPTYNNAAYPGYAVNSGARLLKCDKDLVSNGDSNQFSPQRLSHSDSLCGNQPV
SLMEPNIYPQKAYMHLDYNKHGAYEFKGHGLIHSIKREPMDSPPWSENGHDVNQSMMGGS
RNVMPCVMTTGHHKSSPYIYMQ
NT seq 2049 nt   +upstreamnt  +downstreamnt
atgatcccacctggagactgcatgtacgcgggcaggaagaggaggaagcccgtccagaaa
cagaagccgtcctctgccaacgagaaaagcaacccgtccaagaggcaccgggacaggctc
aacgccgaactggaccgcctggccagcctgttgccgttccctccggacgtcatctccaaa
ctggacaagttgtccgtgctgcgcctcgccgtctcctacctccgcgtcaaaagcttcttc
caagcgagtcaagacaaaccctccaggaagcacgtcaccaccccagcatcctccaaccct
gaacccaggaaagatagccttcctctgggtaccaccatcaatgaaagcagcctcctcctg
gaatctctaacaggctttgccttggtggtgagcagtgacggcatggttttttatgcttcc
tcaaccattgtggactacctgggtttccatcagactgacgtgatgcaccaaaacgtcttc
gactacatccacatagacgaccgccaggagttcagacgccagctccactgggccatgtgt
cccccacaacatcaggcgatgtctggggagccagatagccagttagcggcgggaacaagt
gaagactttgtcgtgagcagcatgttcaactctccggaagcaggggaaattcccccagag
ctctcgtgctttctcaacagatgtttcatagccagagtccgctgtctcctggacagcacg
tctggatttttgacgatgcagtttcagggtcggttaaagttcctccacgggcagaagaag
aagtcgccctctgggacgctggtccctgcccagctgggtctgttctgcatcgccgtgccc
ctcttactgccctccatcaccgagatgaaagtgaaaaatattttaatgcgtggaaagaac
aaaggtggggggattgtctctccgatggagcatggagagagcggggagcacctaaggagg
cattccatcggtggaggaatgggtgacatgacagaccctcttctattcacttgtccccat
ccgggcactacacagcgaagtcaccacgccctctggtcccctctttgcaaagacaacctc
aagtgcagctccgacagcttctacggccaggaggaacccctcaacttctgcaagtcctcc
gtggctgaccacaaaggcgcggccgcgggcctgggcggagggtggcccatgcggcagcgg
gcggggcctgtcagagccgcccagggagtcagctacatcccatccaaccgcttgaacagg
actggccagtacgggaagccctaccgcctctcgccgagctgccacggcggcaggggcgcg
gacgtgtacgtgtcgaagctgtacgggtcgtcggacgcggacgcctactgcgtagacctg
gtgaagagcgaaaacgactttggggagtgctacgaaggccacatgatgtccgagatgccg
cccatcaagatagagcacgactccgactcggagaacggatgcgagatgtacggtcaaacc
tgggcctgccgcaaccaggccaccatcgaccgtcactacgggaacggggcgtacgaccca
agcactggtctgcagcttaaatcggaaacggactactacgacctgcagtactccccgtgc
caacgagggaaagcaggaatcagccccacgtacaacaacgccgcctaccccggctacgcg
gtcaacagcggcgctcgtctgttgaagtgcgacaaagacttggtcagtaacggcgactcc
aaccagttcagcccccagagactctctcactcggactctctatgcggcaaccagccggtc
agcctcatggagccaaacatctaccctcaaaaggcgtacatgcacctggactacaacaag
cacggcgcctacgagttcaaaggtcacggcttgatccactcgatcaaacgggagccgatg
gactccccgccctggtctgagaatggccatgacgtgaaccagtccatgatgggcggctcg
aggaacgttatgccatgtgtgatgaccactggccaccacaagtccagtccctacatttac
atgcagtga

DBGET integrated database retrieval system