KEGG   Xiphophorus maculatus (southern platyfish): 102220641Help
Entry
102220641         CDS       T02923                                 

Gene name
abhd12
Definition
(RefSeq) monoacylglycerol lipase ABHD12 isoform X1
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
KEGG Orthology (KO) [BR:xma00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xma01002]
    102220641 (abhd12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xma04147]
    102220641 (abhd12)
Enzymes [BR:xma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102220641 (abhd12)
Peptidases [BR:xma01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   102220641 (abhd12)
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102220641 (abhd12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Thioesterase Abhydrolase_3 Peptidase_S15 Peptidase_S9 Chlorophyllase2 LIDHydrolase
Motif
Other DBs
NCBI-GeneID: 102220641
NCBI-ProteinID: XP_005813189
Ensembl: ENSXMAG00000016077
UniProt: M4ANS2
Position
22
AA seq 382 aa AA seqDB search
MRRRSSLTAEKDSDPELKQRPGRAAAHPATRGRQGPGEEPGMGKRPFRRLGLLGKIKRMM
MVLLFVYVSIPFIIKLFPSIQAKLVFLNFVRMPYFIDLKRPLDQGLNHTQNLYLEPEAGQ
KIGVWHTVPAQMWRDAQGKDGDWYRSAFTSAHPVILYLHGNAGTRGGDHRVQLYKVLSSL
GYHVVTFDYRGWGDSDGSPSERGMTSDALFVYDWLRQRMEKTLPLYIWGHSLGTGVATNL
VRRLSERGSPPDALILESPFTNIREEAKSHPFSMVYRFLPGFDWFFLDSITANNIRFTND
ENVDHISCPVLILHAEDDGVVPFHLGKKLYSLASRSSSLSGHKVQFVAFPAALAFRHKFI
YRSPELPNILSDFLGAAHPAVA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcggaggcggagctctctgaccgcggagaaggacagcgacccggagctgaagcagcga
cccggcagagcggcggcgcatccggcgacccgaggccgacagggcccgggagaggagccg
gggatggggaagagaccgttcaggaggctggggctgctgggaaagataaagaggatgatg
atggtgctgctcttcgtctatgtctccatccccttcatcatcaagctcttcccctccatc
caggccaaactcgtcttcctcaactttgtgaggatgccgtacttcatcgacctgaagcga
cctctggatcaggggctgaaccacacacagaacctctacctggagcctgaggcaggccag
aagatcggagtctggcacacggttcccgctcagatgtggagagacgctcagggcaaagat
ggcgactggtaccgctccgcctttacctccgcccaccctgtcatcctctatctccatggc
aacgcagggaccagaggcggcgaccaccgggtgcagctgtacaaggtcctcagttcgctg
ggataccatgtggtgacctttgactacagagggtggggcgactcagacggatcgccatca
gagcgagggatgacatcagacgctcttttcgtctacgattggctgagacagaggatggag
aaaactctgccgctctacatctggggccactctctggggactggagtcgcaacgaacctg
gtgagacggctgtctgagcgaggaagtcctcctgacgcactcatcctggagtctccgttc
accaacatcagagaggaggccaagagccaccccttctccatggtgtaccgcttcctgccc
ggcttcgactggttctttctggactccatcaccgccaacaacatccgcttcaccaacgac
gagaatgtggaccacatttcctgtccggttctgattctacacgccgaggacgacggagtg
gttccgttccatctgggcaaaaagctctacagtctggcgtctcgctccagcagcctgagc
ggtcataaggttcagttcgtggcgttcccggcggctctcgccttcagacacaagttcatc
tacaggagcccggagctgccaaacatcctcagtgacttcctgggagcggctcaccccgcc
gtggcgtga

DBGET integrated database retrieval system