KEGG   Xiphophorus maculatus (southern platyfish): 102220656Help
Entry
102220656         CDS       T02923                                 

Definition
(RefSeq) acyl-CoA desaturase-like
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma01040  Biosynthesis of unsaturated fatty acids
xma01212  Fatty acid metabolism
xma03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    102220656
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102220656
Enzymes [BR:xma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     102220656
Lipid biosynthesis proteins [BR:xma01004]
 Desaturase
  First
   102220656
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 102220656
NCBI-ProteinID: XP_005794634
Ensembl: ENSXMAG00000014936
UniProt: M4AKI0
Position
10
AA seq 334 aa AA seqDB search
MTGSEPFEKQQQHKSVNGDVCSEAAGEDAFDHTYEEKEGPKPSKIFVWRNIILMTLLHLG
AVYGLFLIPSASPSTLLWTMTCFLISALGITAGAHRLWSHRTYKASLPLRIFLAFGNSMA
FQNDIFEWARDHRVHHKYSETDADPHNAKRGFFFSHIGWLLVRKHPDVIEKGGKLELSDL
LGDKVVMFQRRHYKLSVLLMCFFIPMFVPWYFWGESLWVAYFVPALLRYTLVLNATWLVN
SAAHMWGNRPYDQNINPRENRFVTFSAIGEGFHNYHHTFPYDYATSEYGCKLNLTTCFID
FMCFLGLAKDRKRVSREVVLSRIQRTGDGSHRSG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacggggtcggagccgtttgaaaagcagcaacagcacaagtcggtcaacggggacgtt
tgctcagaggcagccggagaagatgcgtttgatcacacctacgaggagaaggaaggcccg
aaaccttctaagatctttgtctggagaaatatcatcctcatgactctgttgcatttagga
gcagtttacggcttattcctcatcccttctgcatctccctctacgttgctttggactatg
acctgctttctgataagtgctttaggaattactgcaggggctcaccgcttgtggagccac
aggacctacaaagcttcattacctctgaggatcttcctcgcttttggtaattccatggct
tttcagaacgatatattcgaatgggctcgagaccaccgggttcatcacaaatactcggag
acagacgcagaccctcacaacgccaaaaggggcttcttcttctcccacatcggctggctg
ctggtgcgcaaacatcccgacgtcatcgagaaggggggcaagctggagctgagcgacctg
ctaggcgacaaagttgtaatgtttcagaggaggcactacaagctctctgtgctgctgatg
tgcttctttatcccgatgttcgtgccttggtacttctggggcgagtccctgtgggtggcg
tacttcgtcccggctctgctgaggtacaccttggtgctgaacgccacctggctggtgaac
agcgcggcgcacatgtggggaaaccggccgtacgaccagaacatcaacccaagggagaac
agatttgtcactttcagcgccataggagagggatttcacaactaccaccatacgttccct
tacgactacgccaccagcgagtacggctgcaagctgaacctcaccacctgcttcatcgac
ttcatgtgcttcctgggcctggccaaggaccgcaagagggtgtcccgcgaggtggtcctg
tcccggatacagcgcaccggagacggaagccaccgcagtggctaa

DBGET integrated database retrieval system