KEGG   Xiphophorus maculatus (southern platyfish): 102220955Help
Entry
102220955         CDS       T02923                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-7 subunit-like
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04010  MAPK signaling pathway
xma04260  Cardiac muscle contraction
xma04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102220955
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102220955
   04261 Adrenergic signaling in cardiomyocytes
    102220955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xma04040]
    102220955
Ion channels [BR:xma04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102220955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 DUF202
Motif
Other DBs
NCBI-GeneID: 102220955
NCBI-ProteinID: XP_005804761
UniProt: A0A3B5QK28
Position
13
AA seq 363 aa AA seqDB search
MSSFSTRALTLLSSVFGACGLLLVGVAVSTDYWLLMEEGIVLQQNQTMEVKMALHSGLWR
VCFVAGPEKGRCVASEYFTEPEIEITTENTANILKMVRTATPFPMVSLLFVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPREPEQFFHYHYGWSFA
FAASSFLLKEGAGVMSVYLFMKRYAEEELYRPHPALYRPRMSDCSDYSGQFLHPDSWAPP
QRGRSPSDVSSDISIQLNQTPPPQQTLKGGSSSQATPSSSGPSSAASYQLHPASSSSTSS
SYPHPLHPGATSTLTRMPHVLAHSQSHPHSSGPPPQSLPMVAPPSAVPPPHYHTHTRMSA
SPC
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgttcagcacgagagcgctcacactgctctcgtcggtgtttggagcttgtggg
ttgctgctggtgggcgttgctgtatcaacggactactggctgctgatggaggagggaatc
gttctgcagcagaaccaaaccatggaggtcaagatggcgctccactccgggctctggaga
gtctgttttgttgcaggacctgagaagggcagatgtgttgcatcggagtatttcactgaa
ccagagatagagatcacaacagaaaacacagccaacatactaaaaatggtccggacagcc
acaccgtttcccatggtctccctgctctttgtcttcaccgcctttgtcattagcaatatt
ggtcacatccggccacagcgcaccatactggccttcgtgtctgggatattctttatacta
tcaggtctcagtctggtggtgggtttggttttatacatttccagtattaatgacgaagtg
atgaatcgacccagagagccagagcagttttttcactaccactacggctggtcctttgcc
ttcgctgcctcctccttcctgctcaaagagggtgcaggagtgatgtctgtctacctcttt
atgaagcgttatgcagaggaggagctctaccgcccccatccagcactctaccgcccccgt
atgtctgactgcagcgactacagtggccagtttcttcatccagactcctgggctccacca
cagcggggccgaagtccctctgatgtctcctctgacatctccatccagctcaaccagacc
ccgccgcctcagcaaaccctaaagggcggcagtagctcccaggcaacgccttcttcttcc
gggccttcatcagctgccagctaccagctccatcctgcgtcttcctcctccacctcctcc
tcatatccacacccccttcacccaggtgccacctctaccctcactaggatgccacatgtt
ctcgcccactcgcaatcacatccccattcgagcgggcccccacctcagtccctgccgatg
gtagcacctccctctgccgtgcctcctcctcactatcacacacacacacgaatgagtgcc
tcaccatgctag

DBGET integrated database retrieval system