KEGG   Xiphophorus maculatus (southern platyfish): 102221393Help
Entry
102221393         CDS       T02923                                 

Gene name
acsl3
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 3
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00061  Fatty acid biosynthesis
xma00071  Fatty acid degradation
xma01100  Metabolic pathways
xma01212  Fatty acid metabolism
xma03320  PPAR signaling pathway
xma04146  Peroxisome
xma04216  Ferroptosis
xma04920  Adipocytokine signaling pathway
Module
xma_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    102221393 (acsl3)
   00071 Fatty acid degradation
    102221393 (acsl3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102221393 (acsl3)
  09143 Cell growth and death
   04216 Ferroptosis
    102221393 (acsl3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102221393 (acsl3)
   03320 PPAR signaling pathway
    102221393 (acsl3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:xma01004]
    102221393 (acsl3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xma04147]
    102221393 (acsl3)
Enzymes [BR:xma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     102221393 (acsl3)
Lipid biosynthesis proteins [BR:xma01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   102221393 (acsl3)
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   102221393 (acsl3)
  Exosomal proteins of breast cancer cells
   102221393 (acsl3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 102221393
NCBI-ProteinID: XP_005805933
Ensembl: ENSXMAG00000008269
UniProt: M4A1F3
Position
18
AA seq 719 aa AA seqDB search
MRLKEDLNPMLLLLFHLTVWIYTTITFLPSYLLSWVSRSHRNFYGSEEERAKRPKACSVL
GRSEGPYRAVSATKRLLSSLHPGVDTLDKMFEYAAMRFPQRDCLGTREVVTEEDERQSNG
KVFKKVVLGEYRWLSYKEALTAATQLGNGLASLGQRPKTNIAIFCETRAEWLIAAQACFA
YNFPVVTLYSTLGGPAIAHGLNEAQVTHIITSRELLETRLKAILAEVPRLQHIIVVDNTP
TTWPGFPRGISIYNMATVQKLGARPDKATFERKQPLSSDIAVIMYTSGSTGIPKGVMISH
SNIIASITGMAERIPNLSEEDTYIGYLPLAHVLELCAELVCISYGCRIGYSSPQTLADQS
TKIKKGSRGDTSVLMPTLMAAVPEIMDRIYKNVMTKVEEMNSFQRTLFILAYNYKLEQLS
KGYSTPLCDRLVFRKVRSLLGGRTRVLLSGGAPLSAATQRFMNVCLCCPVGQGYGLTETC
GAGTICEHWDYSTGRVGGPLVCCEIKLRDWVEGGYRSTDKPHPRGEILVGGPNITMGYYN
CEAKKQEDFFVDENGQRWFYTGDIGEIHEDGCLEIIDRKKDLVKLQAGEYVSLGKVEAVL
KNCPLVDNICVYANSDETYVIGFVVPNQKQLLALAGQYGIRGSWEELCNSKAMEELVLKV
ITEAALTAQLERFEIPRKIRLSPEPWTPETGLVTDAFKLKRKELKTHYKDDIERMYGGK
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcaaagaggacctgaatcccatgctgctgcttctcttccacctcacggtgtgg
atctacaccacaattaccttcctgccttcctacctcctcagctgggtctccagatcccat
aggaatttttacgggtcagaggaggaacgggccaagagaccaaaggcttgttcagttctg
ggacgctcagagggaccctacagagcagtcagtgccaccaaaaggctcctttcatcgcta
caccctggagtggatacgctggataagatgtttgagtacgcagccatgaggttcccgcag
agagactgtcttggaacgagggaagtggttacagaggaagatgagcgacagagcaacggg
aaagtgttcaagaaggtagtccttggggagtaccgctggctctcctataaagaggctctg
acagcagcgactcaactgggcaacggtttagcatctttgggtcagcggccgaaaaccaac
attgccatcttttgtgagacccgagcggagtggctgatagctgcccaggcctgctttgcg
tacaacttcccagtggttacactgtactccaccctgggaggtccagccatcgctcatggg
ctgaatgaggctcaagtcacccacattataaccagcagagagctcctggagaccagactg
aaggcgatcttagctgaagttccaaggctgcaacacattatcgtagtggacaacacaccg
accacatggcccggctttccacgtggcatcagcatctacaacatggccactgttcagaag
ctgggagccagaccagataaagcaacatttgagcgtaagcagcctctgtcttcagacatt
gcagtcatcatgtacaccagtggttccacaggcattccaaagggcgtcatgatctcccat
agcaacatcatcgccagcattacagggatggcagagaggatacccaacctgagtgaagag
gacacctacatcgggtacctccctcttgcgcatgtgcttgagctgtgcgcagagcttgtc
tgcatttcttatggctgccgaattggctattcctcacctcaaacacttgctgaccagtca
accaagatcaagaaaggaagcaggggagacaccagtgtcctaatgcccactctgatggca
gctgtcccggagattatggatcgcatctacaagaatgtgatgactaaggtggaggagatg
aacagtttccagcgaactctcttcattttagcatataactacaaactggaacagctttca
aaaggatacagcacaccactgtgtgacaggcttgtgttcaggaaagttcgttctctgctc
gggggtcgaacacgagttttgttatcaggcggagctccactttctgccgccacacagcgc
ttcatgaatgtgtgtttatgttgcccagtgggtcagggatatggcctgacagagacctgt
ggagcagggacgatatgcgaacactgggattacagcactggtagagtgggagggccgctg
gtttgctgtgagatcaagctcagagactgggtggaaggcggttaccgaagtactgacaag
cctcatcccaggggagagattcttgttggtggacctaatatcaccatgggatattacaac
tgcgaggcaaaaaaacaggaggacttttttgtcgatgaaaacggccagcggtggttctac
actggggacattggagagattcatgaagacggatgtctcgagattatcgatcgtaagaag
gacctggtgaagctgcaggcaggagagtacgtctccctgggaaaggtggaggccgtgctg
aaaaactgtcctctggttgacaacatttgtgtttatgccaacagtgatgaaacatacgtg
attggctttgtggtgcccaatcagaagcagctgctggctctggctggccagtacggtatc
cgggggtcatgggaggagctgtgcaacagtaaggccatggaggagctggttcttaaggtc
atcactgaggctgcgctgacagcccaactggagcgatttgagattcctcgcaagatccgt
ctgagcccagagccctggacgcctgagacggggttggtgaccgatgcgttcaagctcaag
cgcaaggagttgaagacacattacaaagacgatattgagagaatgtatggtggaaaataa

DBGET integrated database retrieval system