KEGG   Xiphophorus maculatus (southern platyfish): 102221703
Entry
102221703         CDS       T02923                                 

Definition
(RefSeq) deoxycytidine kinase-like isoform X1
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00230  Purine metabolism
xma00240  Pyrimidine metabolism
xma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102221703
   00240 Pyrimidine metabolism
    102221703
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     102221703
SSDB
Motif
Pfam: dNK AAA_18 AAA_33
Other DBs
NCBI-GeneID: 102221703
NCBI-ProteinID: XP_005795147
Ensembl: ENSXMAG00000017897
Position
12
AA seq 320 aa
MAALHRLLVLHRVSEIQKQGSGLMQLRRFASTLWKPPNSSFLRGRTTICSYMDKNIGDPS
VSCSKNYSSSSKDGASRVKRVSIEGNVAVGKSTFAKLLQSVSTDWEVVQEPVGKWQNIEI
KTSKEIDASPQGTANNLLEMMYQDPQRWSYTFQTYSCVSRMRIQLQAPPAHLLNAKETPV
QVYERSVYSDRYIFALNMFELGCINTTEWVTYQDWHSLMVEQFGHRVELEGIIYLRASPK
MCMERLKSRGRPEEEGVKLDYLETLHRQHEKWLVEKSTEIHFEKLKKIPVLQLDASVAFN
SDPKVQNLFVAKVKDFFKTL
NT seq 963 nt   +upstreamnt  +downstreamnt
atggctgccctgcaccgactacttgtgttacaccgggtttctgaaatccagaaacagggt
tcaggtctgatgcagctcaggaggtttgcatccacactgtggaaaccaccaaacagctca
tttctgagaggaaggacaactatctgcagctatatggataaaaatataggggacccaagt
gtttcttgctctaaaaactactcgagttcatctaaggatggtgcatcgcgagtgaagaga
gtttctatcgagggaaacgtcgctgttggaaagtcaacctttgcaaaactcctgcagtcg
gtttctacagactgggaggtggtgcaagagcctgtcggtaaatggcagaacattgagatc
aagacctcaaaggaaatagatgcttcaccccaaggaacagccaacaacttgctggagatg
atgtaccaggaccctcagcgctggtcctacacatttcaaacatattcctgtgtgagccga
atgaggatacaacttcaggcccctcctgctcatctcctcaacgcaaaggaaacccctgtc
caggtgtatgagcgctcggtctacagtgacagatacatctttgctctgaatatgtttgaa
ctgggctgcatcaacaccactgaatgggtgacgtaccaggactggcactccctgatggtg
gagcagtttggacaccgggtggagctggagggcatcatctacctcagagcctcacccaag
atgtgcatggagcgtctcaagtcacggggaagacctgaggaggagggagtgaagctggac
tacttggagacgctgcataggcagcatgagaagtggctggtagagaagagtactgagata
cactttgagaagttgaaaaagatccctgtgttgcagctcgatgccagtgtggcatttaat
agtgatcccaaagtgcagaatctgtttgttgcaaaggtgaaggacttctttaaaactttg
tga

DBGET integrated database retrieval system