KEGG   Xiphophorus maculatus (southern platyfish): 102222747Help
Entry
102222747         CDS       T02923                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6 isoform X1
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04010  MAPK signaling pathway
xma04060  Cytokine-cytokine receptor interaction
xma04068  FoxO signaling pathway
xma04210  Apoptosis
xma04217  Necroptosis
xma05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102222747
   04068 FoxO signaling pathway
    102222747
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102222747
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102222747
   04217 Necroptosis
    102222747
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102222747
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xma04147]
    102222747
   04052 Cytokines and growth factors [BR:xma04052]
    102222747
   04090 CD molecules [BR:xma04090]
    102222747
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102222747
Cytokines and growth factors [BR:xma04052]
 Cytokines
  Tumor necrosis fators
   102222747
CD molecules [BR:xma04090]
 Proteins
  102222747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF PhoR SURF1 DUF2681 DUF1258
Motif
Other DBs
NCBI-GeneID: 102222747
NCBI-ProteinID: XP_005795736
Ensembl: ENSXMAG00000011404
Position
9
AA seq 269 aa AA seqDB search
MSRDQRYPFPQVFLVDEGGGQRSPATPPNLIPCWSFPQARETVRSHSKSRGCMGVSCSVA
MIVLMLFLLVFAALGFEAWQILRLQEKLKDVEKVEHDLVTEFHAPQKQIGLYNPDSNGEE
KTKKPAAHVLGRIVHQPSQMTLRWEPKAGQAFTSGEVAYKIEDGALQVNESGLYHVYSRV
ELIFKNCQPTSSFDHVVFVRRAGQSKLLTLMEAHRSGFCVQKPNGPWTAENYLGGGLQLM
KFDRVYVNVSHPTYLSHSHYGNFFGLYKI
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtgaccagaggtacccgttccctcaggtgttcctggtggacgagggcggaggt
cagcgctcgccggcgacgccgccgaacctcatcccctgctggtcgttccctcaggcccgg
gagaccgtgaggagccacagcaagagccgaggctgcatgggggtcagctgcagcgtggcc
atgatagtgctgatgttgttcctgctggtgttcgccgccctgggctttgaagcctggcag
atcctgagactccaggaaaaactcaaagatgtggagaaggttgaacatgacctcgtgact
gagtttcatgcaccccagaagcaaattggtctctataaccccgactcaaacggagaagag
aaaacgaagaaacctgcggctcatgttctcgggcgcattgtgcatcaaccgtcccaaatg
actttgcgatgggaaccgaaagcaggccaggccttcacgtccggggaggtcgcttacaaa
atcgaagacggcgccctgcaggtcaacgagtcggggctctaccacgtctactctcgagtg
gagctgatcttcaagaactgccagcccacgtcctcgttcgatcacgtcgtgtttgtgagg
cgagcaggacagtccaaactcctgactctgatggaagcccacaggtcgggtttctgcgtc
cagaaacccaacggcccgtggactgcagagaactacctcggcggcggcctgcagctgatg
aagttcgacagggtttacgtgaacgtgtcgcacccgacctatctcagccactcacattat
ggcaacttcttcggtctgtacaagatctga

DBGET integrated database retrieval system