KEGG   Xiphophorus maculatus (southern platyfish): 102222791Help
Entry
102222791         CDS       T02923                                 

Gene name
gad2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00250  Alanine, aspartate and glutamate metabolism
xma00410  beta-Alanine metabolism
xma00430  Taurine and hypotaurine metabolism
xma00650  Butanoate metabolism
xma01100  Metabolic pathways
Module
xma_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    102222791 (gad2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102222791 (gad2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102222791 (gad2)
   00430 Taurine and hypotaurine metabolism
    102222791 (gad2)
Enzymes [BR:xma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102222791 (gad2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 102222791
NCBI-ProteinID: XP_005805764
Ensembl: ENSXMAG00000008296
UniProt: M4A1I7
Position
21
AA seq 585 aa AA seqDB search
MASHGFWSLGGENAGANTGSQSPSTPRAWCQAAAQKLSGGIGSKLCALLNVGEGEKPAEP
AAMQPPQTAAGSCGCNKSCTCTKGTDVGFSDLYSTDLLPAMDGDTKTMTFLQEVVDILMA
YIVESFDRETKVIDFHYPNELLQLNNWELQDEPATLDDILISCRATLKYAIKTAHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEVAPVFVLLEYVTLKKMREIIGWADGRGDGIFS
PGGAISNMYAMLLARFKMFPEVKEKGMSSVPKLVAFTSEHSHFSIKKGAAALGIGTESVI
CIKADECGKLIPADLERRILEAKHKGFVPFFVSATAGTTVYGAFDPLIAISDICKKYNVW
FHVDGAWGGSLLMSRRHRWKLDGVERANSVTWNPHKMMSVPLQCSALLVREEGLMQSCNQ
MHACYLFQQDKQYDLSYDTGDKALQCGRHVDIFKLWLMWRAKGTIGFEAQIDKCLELSEY
LYNKIKDREGYQMVFDGKPQHTNVCFWYLPPGIRYMEDKEEKKKRLHKVAPVIKARMMEY
GTTMVSYQPQGDKVNFFRMVISNPAATFEDIDFLIEEIERLGHDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgcacggcttctggtccctcggcggggaaaatgcgggggccaacaccgggagt
caaagccccagcacccccagggcttggtgccaagcagctgcccagaaattatccggagga
attggatcaaaattatgtgcgctgctaaatgtcggagaaggggagaaacccgccgagccg
gccgccatgcagccgccgcagaccgctgcgggaagctgcggctgcaacaaatcctgcacc
tgcaccaaaggcaccgatgtgggcttctcagacctctactcaacagacctgctgccagcc
atggacggagacaccaaaacgatgaccttcctgcaggaggtcgtggatattttaatggcc
tacatagtcgagtcgttcgaccgggaaacgaaagtgatcgattttcattatcccaacgag
ctgctgcagctgaacaactgggagcttcaggacgagccggccacgctggatgacatcttg
atcagctgccgcgcaactctcaaatacgccatcaaaacagcgcaccccaggtacttcaat
cagctctccacaggattagacatggtcgggctggcagccgattggctcacatccacggcc
aacaccaacatgttcacctatgaggtggcgcctgtgtttgtgctgctggagtacgtcacc
ttgaagaagatgagggagatcattggctgggcggacgggcgaggagacggcattttctca
ccggggggtgccatttccaacatgtacgctatgctgctggcccgcttcaagatgttccct
gaagtgaaggagaaaggaatgtcgtccgtccccaaactggtggccttcacatccgaacac
agccatttttccatcaaaaaaggagcggcggcgcttggcattggaactgaaagcgtgatc
tgcatcaaggcagacgaatgtggcaaactgatccccgccgacctggagaggagaatactg
gaggcgaaacacaaggggtttgtaccgttctttgtgagtgcgacagctgggacaaccgtg
tacggcgcctttgacccgctcatcgccatctctgacatctgcaaaaagtacaacgtctgg
tttcacgtggatggagcgtggggagggagtctgctcatgtcccggagacaccggtggaaa
ctggacggcgttgaaagggccaactctgtgacctggaaccctcacaaaatgatgtccgtc
cccctgcagtgctccgccctgctcgtcagagaggagggtttgatgcagagctgcaaccag
atgcacgcctgctacctcttccagcaggacaaacagtacgacctttcctacgacaccggg
gacaaagcgctgcagtgtggacgccatgtggacatcttcaaactctggctgatgtggaga
gcgaagggaaccatcggcttcgaagcccagattgacaaatgcttggagctgtcggagtat
ctgtacaacaaaatcaaagacagagaaggataccagatggtgttcgatgggaagcctcag
cacaccaacgtctgcttctggtacctccccccggggatccgctacatggaggacaaagag
gagaagaagaagcgccttcacaaggtggctccagtcatcaaagccaggatgatggagtac
ggcaccaccatggtcagctaccagccacaaggcgacaaggtgaacttcttccgcatggtg
atctccaaccctgctgctaccttcgaggacatcgacttcctcatcgaggaaatcgagcga
ctcggccatgatctataa

DBGET integrated database retrieval system