KEGG   Xiphophorus maculatus (southern platyfish): 102224005Help
Entry
102224005         CDS       T02923                                 

Gene name
htr4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4 isoform X1
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04020  Calcium signaling pathway
xma04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102224005 (htr4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102224005 (htr4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xma04030]
    102224005 (htr4)
G protein-coupled receptors [BR:xma04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    102224005 (htr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Git3
Motif
Other DBs
NCBI-GeneID: 102224005
NCBI-ProteinID: XP_023183909
Position
23
AA seq 553 aa AA seqDB search
MSTVSSHKAKRRQLLRSRLSGHNPRSFKKPSRFPQLSAGVSALLFLQSVPPASQPAVRSS
ARRLFAHGRVSKFRHWSLLRCAPSTQLSSPDRQLQSAASFFFLLSLLLICCFTEEQRGFG
SWVFSVVTCFQDPAPSQRNGTLCIYGYMNASAAGQMPVMEELVSESDSMPKRLALICFLS
LVMLMSVLGNLLVMVAVCKDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVHQHWI
YGETFCLVRTSLDVLLTTASILHLCCIALDRYYAICCQPLVYRNKMTPMRVTLMIGGCWV
IPTFISFLPIMQGWNSIGIDHLIEERRHNGSSNSTSCVFMVNKPYALTCSLVAFYIPLVL
MVLAYQRIYITARAHALQISMLQRAGGAGACTAGTSGASPGVGATSESADHQRNHRMRTE
TKAAKTLCIIMGCFCLCWAPFFVTNVVDPFIGYTVPEQLWTACLWLGYINSMLNPILYAF
LNKSFRRAFLIILCCGRKRYRRPSIMATGTTCTATQINGSTHVLKYSVLHNGNHKEQNKK
SLHTNIGSRESCL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgtgagttcacacaaagcgaaacggcgtcaactcctccgcagcagactgtcc
ggacacaatccgcgttcctttaaaaaaccttcgaggttcccccaactctctgcaggggtt
tctgcactcctctttttacagagtgtccctccagcgtcccaaccagcagtgcgctcttca
gctcgccggctttttgcgcacggacgtgtctccaaattccgccactggtctttgctgcgc
tgcgctccttccactcagctgagcagtcccgaccgtcaactacagtcagcggcttctttc
ttttttttgctctcactattacttatttgttgttttactgaagagcagcggggttttggc
tcatgggtatttagtgtcgtgacatgctttcaggacccggcgccttcacagagaaatggg
actctctgcatttatggttacatgaatgccagcgctgcaggccagatgccggtgatggag
gagcttgtcagtgagagtgacagcatgccaaagcggctggcactcatctgcttcctgtct
ctggtcatgctgatgagcgtcttgggaaacctgctggtcatggtggccgtctgcaaagac
agacaactcaggaaaatcaagaccaactatttcattgtgtctctggcatttgctgatttg
cttgtgtcagtgcttgtgatgccgtttggtgccatcgagctggtccaccagcactggatc
tacggtgagacgttctgtctggttcggacgtcgttggacgttcttctgacaaccgcgtct
atactccacctgtgttgcatcgctctggataggtactacgctatctgctgccagccgctg
gtctaccggaacaaaatgacgcccatgcgagtgactttaatgatcggtggctgctgggtc
attcccactttcatctctttcctgcccatcatgcagggctggaacagcatcggtatcgac
cacctgattgaggaaaggcgccacaatggaagcagcaactccacttcttgtgtttttatg
gtcaacaagccatacgccctcacctgctctttggtggccttctacatccctctggtcctc
atggtgctggcttaccagaggatctacatcacggctcgcgcacacgccctgcagatcagc
atgctacagcgggcaggtggggctggggcctgcactgctggtacctccggtgcaagccct
ggagtgggtgcaacatcagagtctgctgaccatcaacgcaaccatcgtatgcgaacagaa
acaaaagcagcaaagactctatgcatcattatgggatgtttctgcctctgctgggcacca
ttctttgtcaccaatgtggtggacccatttataggctatacagtgcccgaacagctgtgg
accgcctgcctgtggctgggttacataaactccatgctcaaccccattctctacgccttc
ctcaacaaatccttccgccgtgccttcctcatcatcctatgttgcgggaggaagaggtat
cgcaggccatccatcatggcaacaggcacgacctgcacagccacgcagatcaacggttca
acacatgtactcaagtattctgttcttcacaacggaaatcacaaagagcagaataagaag
tctttgcacacaaacatcggctcccgcgagtcctgcttgtga

DBGET integrated database retrieval system