KEGG   Xiphophorus maculatus (southern platyfish): 102224543Help
Entry
102224543         CDS       T02923                                 

Definition
(RefSeq) cis-aconitate decarboxylase-like
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    102224543
Enzymes [BR:xma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     102224543
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-GeneID: 102224543
NCBI-ProteinID: XP_005795408
Position
23
AA seq 90 aa AA seqDB search
MVLDSIGVGLIGSTTDVFDLALQHCQHMYAPDFISSVYGRSNVRLSPTLAAFVNGVASQS
LDFDEPWHPATHPSGAVPPLLVLSDMMPYS
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atggtgctggacagcattggggtcggcctcattggaagcacaacagatgtctttgatctg
gccctgcagcactgccagcacatgtatgcacctgatttcatcagctctgtgtacggccgc
agcaacgtccggctttccccaaccctggctgctttcgtcaacggagtggcatctcagtcc
ttggactttgatgaaccctggcatccagcaactcatccatcaggggccgttcctcctcta
ttagtgctcagtgacatgatgccatattcctga

DBGET integrated database retrieval system