KEGG   Xiphophorus maculatus (southern platyfish): 102225120Help
Entry
102225120         CDS       T02923                                 

Gene name
tymp
Definition
(RefSeq) thymidine phosphorylase isoform X1
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00240  Pyrimidine metabolism
xma00983  Drug metabolism - other enzymes
xma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    102225120 (tymp)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102225120 (tymp)
Enzymes [BR:xma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     102225120 (tymp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C
Motif
Other DBs
NCBI-GeneID: 102225120
NCBI-ProteinID: XP_005810232
Ensembl: ENSXMAG00000006462
Position
17
AA seq 347 aa AA seqDB search
MISGRGLAHTGGTLDKLESIPGFSVQQSADQIRTILAAVGCCIVGQTEMLVPADRVLYAL
RDATSTVDSLPLITGSIISKKGAESLSALVLDVKFGRAALYKDLQSAKQLAQLLMEAGGS
LGIRTGAVLSRMDGTIGRCVGNSLEVIESLETLKGNGPDDLMELVTTLGGMLLEMTNLAP
GLSEGRKQIYDAVIGGAALSKFEAMMTAQGVANQTARTLCSTHTDYYSVLRKSDHQLELK
TPTDGVVVGVDGLVLAQVLQELGAGRSKAGEPINHSVGAELLVSPGQTVQKGASWLRIHY
EDPVPGPDQINLLQKALTVGKNNNSEAEHVCTLVAEILPPHREIMSH
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtgggcggggcttggctcacaccggaggaactctggataaactggaatccatt
ccaggattcagcgtccagcaatcagccgaccagatccggaccatcctggccgccgtgggc
tgctgcatcgtgggtcagacggagatgctggttccggctgatcgggttctgtacgctctg
agggacgctaccagcaccgtggacagcctcccactcattactggttccatcatctcaaag
aaaggagccgagtctctgtccgctctggtgctggacgtgaagttcggacgcgcggcgctg
tacaaagacctgcagagtgccaagcagctcgctcagctcttaatggaagcaggtggcagc
ctgggcatccgaacgggagccgtgctgagccgcatggacgggacgatcggccgatgtgtg
ggaaacagcctggaggtgatcgaatccctggagacgctgaagggaaacggacccgacgac
ctgatggagctggtcacgacacttggtggaatgctgctggagatgacgaacctggcgccg
ggcctatcagagggcagaaagcagatttacgacgctgtgattggtggagctgccttgtct
aaattcgaggccatgatgacggctcagggcgtggccaatcagacggcccggacgctttgc
tccacccacacagattactacagcgtcctgaggaagtctgaccatcaactggaacttaag
actcctacagatggagttgttgtcggtgtggatggtttggttctggctcaggttctgcag
gaattgggggcggggcgatcgaaggcaggggagccaatcaatcacagcgtgggggcggag
cttctggtgtctcccggtcagactgtacaaaaaggtgcctcctggttgcggattcattat
gaggatccggttccgggtccagatcagatcaacctgctgcagaaagctctgactgtagga
aaaaacaataacagcgaagcagaacatgtgtgcactttagtagcagaaatactgccgcct
caccgtgagattatgtcacactga

DBGET integrated database retrieval system