KEGG   Xiphophorus maculatus (southern platyfish): 102225973Help
Entry
102225973         CDS       T02923                                 

Gene name
xpo5
Definition
(RefSeq) exportin-5
  KO
K14289  exportin-5
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma03013  RNA transport
Brite
KEGG Orthology (KO) [BR:xma00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102225973 (xpo5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xma03016]
    102225973 (xpo5)
   03036 Chromosome and associated proteins [BR:xma03036]
    102225973 (xpo5)
Transfer RNA biogenesis [BR:xma03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    102225973 (xpo5)
Chromosome and associated proteins [BR:xma03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     102225973 (xpo5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 IBN_N
Motif
Other DBs
NCBI-GeneID: 102225973
NCBI-ProteinID: XP_005801694
Ensembl: ENSXMAG00000002870
Position
22
AA seq 1221 aa AA seqDB search
MAEQVAAMCDQLIKAVMVIMDAETSQIYRLEALKFCEEFKETSTLCVPCGLHLADKSQPA
VVRHFGLQILEQVIKFRWNNMQQQEKVQLKECAMQLLTTGTHSILEEESHVKDALSRIVV
EMIKREWPQHWPDMLKEMESLSSQGEAQTELVMLILLRLAEDVITFQTLPAQRRRDIQQT
LTQDMDNIFSFLLAILHINVEDYRKSKEEPGLVLKAKAHCRVAVATLNTLAGYIDWVTLV
HITSRNCQLLEMLCLLLSEPELQLEASECLLIALSRKGKLEERKPFMLLFNDVAIQYILS
AAQSADGLAICPNSSKPQEVEVVERRYVFLKRLCQVLCALGFQLCSLVGSCSEVEVPPNL
SKYTEALLAFTTHSSQFLKSCTVSTWASLFRHENLSKVPVVVEMALKYLKVSTTNLVRTG
FPSRQDSPSCVYSRMDFDSDEDFNSFFSTYRSQHGDVLRTLSRIVPVEAFHTAAEWLRFQ
VASPVDPGETTSKTAEGLCSLMSPSVLQWDALTVFMECVMHQIFKSLDEEKLPIDQSMEL
LQGVLNYETREPLILSCVLSNISALFPFVTHRPQFVPQVLYKLFKAVTFHIDLENKAPRS
RAVKNVRRHACSAIIKICRDYPQFILPCFDMFYNHMKELFANEALLTFLEKCSQMEALVL
ISNQFKDFEKQKAFLDELMAPIITQWTSEEMTSVLWDPVKFLSFVGADEVITEQREERDT
AGPNRGQLSFCLYAMLAVVKRARWPADLEEARAGGFVVGCNPAGAPIYRNPCAAQFLAFL
PNLLALIRTQNSLFMPENVVRLSETFCRAYDVMDGDKLVILGLPQPPLDIYDAPVHKSLL
DRMQGFFNSLFENCFHILGNAGLALLQDFYTVESLAEGIIGSAFTSLDHVPDHRLRSMIR
LFLKQLVISCPPEYHDSLLRPLLGPLFTYMLQRLNIKWQLINQRTSVNDEDEEEQVVYED
CAVTQEMLEEQLVRLLTREVLDLLNVSCISRKVPEQAANKEELDEEDVVMELAQVASSPQ
PTEELSELGKCLMKHENVYMSLLTLSFTSLSWKDTTNCHRTASMVCWNLLRQVVAGNLLT
EAVTWFYTSVLRALQVHGQHEACNTPLCNLAMLIYENLRPRYIELRAVMTQIPNISIEAL
DLYDQRLVEPNAQKVGEKKRRDQFKKLLAGTIGKALCQQFRKEVHIRNLPSLFKKPKPDK
DIVETEQLGLAALFSSENDVL
NT seq 3666 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcaggtggctgccatgtgtgatcagcttataaaagccgtgatggtgataatg
gacgcagaaaccagccagatttaccgtctggaggccctgaagttttgtgaagaatttaaa
gagacgagcaccctttgtgtcccatgtggcctacacctagcagacaaaagtcagccggct
gtagtgagacactttggcttacaaatactggagcaggtcatcaagtttcgatggaacaac
atgcagcagcaagaaaaggtccagctgaaagagtgtgccatgcagctgctaacaactggc
acccattctatcctggaggaagagagccacgtcaaagatgccctatctcggattgtggtg
gaaatgattaaaagagaatggcctcaacattggccagacatgctgaaagagatggagtct
ctctctagccaaggggaggcacagaccgagctggtcatgctgatcctcttgaggctggca
gaggacgtgatcaccttccagacgttacccgctcagcggcgtagagacatccaacagaca
ctcacccaggatatggacaacatcttcagttttttgttggccattctgcatatcaatgtt
gaggactaccgcaaatcgaaggaggaaccaggccttgtactgaaggccaaagctcactgt
cgagtggccgtggccacgctgaatacgctcgcaggctacatagattgggtgacactggtg
cacatcacttccaggaactgtcagctgctggagatgctgtgtctgttgctgagtgaaccc
gagctgcagctggaggcctcagagtgcctgcttattgctttaagccggaagggcaaactg
gaggagaggaaacccttcatgctgctgtttaatgatgtggccatccagtatatcctgtct
gcagcccaatccgcagatggtttagcgatatgtccaaattcctccaaaccacaagaagtg
gaggtggtggagcggcgctacgttttcctgaagcggctctgtcaggtcctatgcgctcta
ggattccagctctgctcgttagtgggttcatgttcagaggttgaagttcctccaaatctc
agcaagtacaccgaagccttattagcctttactacacattccagtcagtttttaaaatct
tgcactgtgtcaacatgggccagtttgttcagacacgagaatctatcaaaagtccctgta
gttgtggagatggccctcaaatacctcaaagtatcgacaaccaaccttgttaggactggc
tttccttctagacaagacagccctagttgtgtgtactcacgaatggacttcgacagtgac
gaggacttcaactctttcttttccacttatcggtcgcagcacggggacgttttgaggaca
ctaagtcgtatcgttccagtagaagctttccacaccgcagcagaatggcttcggttccag
gtcgccagtccagttgatcctggagaaacgacatcgaagactgcagagggtctgtgttcc
ttgatgtctccatccgtccttcagtgggatgcgctgactgtcttcatggagtgtgtgatg
catcagatcttcaaaagcttggatgaggagaagttgccgatagatcagagcatggagctc
ctgcagggcgtgctgaactacgaaaccagagaaccactcatcctgtcctgtgtgctgagc
aacatttctgccctctttcccttcgtcacccacaggccacagtttgtgccacaggtcctc
tacaagctattcaaagccgtcacgtttcacattgatttggaaaacaaggcaccccggagt
cgagctgtgaagaatgttcggagacacgcgtgctcggctatcatcaaaatttgccgggat
tacccacagtttatccttccttgctttgacatgttttacaaccacatgaaagagttgttt
gcaaatgaagccttgctgactttcttggagaaatgctcccagatggaagctctggtgctc
atcagtaaccagtttaaagactttgaaaagcaaaaggcttttctagatgaactaatggcc
ccaataatcactcagtggacctctgaggagatgacaagcgtactttgggatcctgtcaag
ttcctgtcgtttgttggtgcggatgaagtgatcacagagcaaagagaagagagagataca
gctggacctaacaggggtcaattgagcttctgtttgtatgcaatgcttgcggtggtgaag
cgtgcgcgatggcctgcagacctggaagaagcgagagccggtggatttgtggtgggctgc
aatcctgctggagcccccatctacagaaacccttgtgcagctcagtttctggccttcctg
cccaacctgctggctctaataaggactcagaacagcttgttcatgccagagaatgtagtt
cgtcttagtgagactttctgcagagcttatgatgtgatggatggagataaactcgtaatt
cttggtctcccacagcctcctctggatatttatgatgctccagtgcataaaagcctcttg
gatcgcatgcagggattctttaactcgttatttgaaaactgcttccatatcctgggtaac
gcaggtctggctctgctgcaggacttctacaccgtggagagtctggctgaaggaatcatt
ggctctgcctttacttccctcgaccacgtgcctgaccacagactccgctcaatgattcgg
ttgtttttgaagcagctagtgatctcgtgtcctccagagtatcatgacagtctgctgcgc
cctctgctggggcctttgttcacctacatgctgcagagactaaacataaagtggcagctc
atcaaccagaggacatctgtcaatgacgaggatgaggaggagcaggtggtctacgaggac
tgcgctgtgactcaggagatgttggaggagcagctggttcgcctgctcaccagggaggtt
ctggatctgctcaatgtaagctgtatttccagaaaagtgcccgaacaagcagcaaataaa
gaggaactcgatgaggaagatgtggtgatggagttggcgcaggtagcgtcttcccctcaa
cccactgaagagctgagtgagcttggaaaatgcttgatgaaacacgagaatgtgtatatg
tcattgttgaccctctcgttcacctcactgtcctggaaggacaccacaaactgccaccga
acggcgtccatggtctgctggaacctcctgcggcaggttgtagcaggtaacctcctcact
gaagcggtcacatggttctacaccagcgttctcagagctctgcaggttcacgggcaacat
gaagcctgcaacactcccctctgtaacctagcaatgctcatctacgaaaacctgcggcct
cgctacattgagctgcgggcagtgatgacccaaattccaaacatcagcattgaagctctg
gacctctacgatcaaaggctggtggaacccaatgcccagaaggttggagagaagaaaagg
agagaccagttcaagaagctccttgcaggaactatcgggaaagctctctgccagcagttc
aggaaggaggtccacatccgcaaccttccatcactcttcaagaagccgaagccagacaag
gatatagtggagactgaacaactgggccttgcagctctcttcagttcggagaatgacgtg
ctgtag

DBGET integrated database retrieval system