KEGG   Xiphophorus maculatus (southern platyfish): 102226618Help
Entry
102226618         CDS       T02923                                 

Gene name
sept5
Definition
(RefSeq) septin-5 isoform X1
  KO
K04557  septin 5
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
KEGG Orthology (KO) [BR:xma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xma04131]
    102226618 (sept5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:xma04812]
    102226618 (sept5)
Membrane trafficking [BR:xma04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    102226618 (sept5)
Cytoskeleton proteins [BR:xma04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     102226618 (sept5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin RsgA_GTPase MMR_HSR1 GTP_EFTU AAA_23 AIG1 AAA_16 Roc Ras AAA_22 AAA_29 AAA_24 AAA_7 Dynamin_N NACHT ABC_tran
Motif
Other DBs
NCBI-GeneID: 102226618
NCBI-ProteinID: XP_014323834
Ensembl: ENSXMAG00000014644
Position
12
AA seq 390 aa AA seqDB search
MDAIMLQEKLVERLLCPRVRTARQKEKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGM
GKSTLVNSLFLTDLYKDRKLLNAEERINQTVEIIKHTVDIEEKGVKLKLTIVDTPGFGDA
VNNNECWKPITDYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFIPPFGHGLRPVDVEFM
KALHEKVNIIPLIAKADCLTPNEIKKLKDRIREEIEKFGIKVYQFPECDSDEDEEFKQLD
KELKECTPFAVIGSNTVVEARGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRSHMHDL
KDVTCDVHYENYRAQCIQEMTRFVSLCEKESDEEKSKLAQDNRMESPIPILPLSTPDADT
EKLIKMKDEELKRMQEMLNKMQQQMHDKDQ
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggatgccatcatgctgcaagagaaactggtggaacggcttctgtgcccacgagtgaga
accgcaagacagaaggagaaacagtatgtgggttttgcaactctgccaaaccaggtccac
aggaaatctgtgaagaaaggcttcgatttcaccctgatggttgcaggagagtctggtatg
gggaagtccactctggtcaacagtctgttcctcacagacctctacaaagacaggaagtta
ctaaatgccgaagagcggattaaccaaactgtggagatcatcaagcacaccgtcgacatc
gaggagaagggagtgaagctcaagctgaccatagtggacacgccggggtttggagatgcc
gttaataacaatgagtgctggaagccaatcacagattacatcgatcagcagtttgagcaa
tacttcagagacgagagcggcctgaacaggaagaacatccaggacaacagagtgcactgc
tgcctctacttcatccctccatttggccatggcttacgtcccgtggacgtggagttcatg
aaggctcttcatgaaaaagtgaacatcattcctctcatcgcaaaagccgactgcctcact
cccaacgagataaaaaagcttaaagacagaatacgagaggaaatagagaagtttgggatc
aaagtgtaccagttccctgagtgtgactctgacgaggacgaggagttcaagcaactcgac
aaagaactgaaggagtgcacgccgttcgctgtgatcggcagcaacaccgtggtggaggcg
agagggcagcgggtcagaggaaggctgtacccctgggggatcgttgaagtggaaaaccag
tcgcactgcgactttgtgaaactgaggaacatgctgatccgctcgcacatgcacgacctt
aaagacgtaacctgcgacgtccactacgaaaactacagagcgcagtgcatccaggagatg
actaggtttgtctctctgtgtgagaaagagtctgatgaggagaaaagtaaactggctcag
gataaccggatggagagtccaatccccatcctgccgctgtccactccagacgcagacact
gagaagctaatcaagatgaaagacgaagagctgaagaggatgcaggaaatgctgaataag
atgcagcagcagatgcacgacaaggatcagtga

DBGET integrated database retrieval system