KEGG   Xiphophorus maculatus (southern platyfish): 102227037Help
Entry
102227037         CDS       T02923                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit-like
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04010  MAPK signaling pathway
xma04260  Cardiac muscle contraction
xma04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102227037
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102227037
   04261 Adrenergic signaling in cardiomyocytes
    102227037
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xma04040]
    102227037
Ion channels [BR:xma04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102227037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 SUR7 COPI_assoc DUF716 SUa-2TM DHHC
Motif
Other DBs
NCBI-GeneID: 102227037
NCBI-ProteinID: XP_005808932
Ensembl: ENSXMAG00000001166
UniProt: A0A3B5RDC9
Position
16
AA seq 276 aa AA seqDB search
MSACGRKALTLLSSVFAISGLGLLGVAVSTDYWLYLEEGVIMPLNQTADIKTSLHSGLWR
VCFLAGEESGRCSTIEYMMPTSLQLTSESTGNVLKMIRSSTPFPLVSLFFMFIGFVLNNI
GHVRPHRTILAFVSGIFFILSGLALVVGLVLYISSINDEMLNRTKSSEVYFSYKYGWSFA
FAALSFLLTESAGVMSVYLFMKRYTAEEIYQARRPNFYRPRLSNCSDHSGQFLHPESWSR
GRSPSDISSEASLQMSASYPALLKCPDYDQVSSSPC
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgtgcggcaggaaggctctgactttactcagcagtgtctttgcaatcagtggc
ctggggctgctgggagtggcggtgagcacagattactggctctacctggaggagggagtc
atcatgcctctgaaccagacggctgacatcaagacgtcactgcactcaggtctctggagg
gtctgctttctggctggtgaggaatccggccgctgctccaccatcgagtacatgatgcca
acgagtctccagctgacgtcagagtccacaggaaatgtactcaagatgatccgctcatcg
accccattccctctggttagcctcttcttcatgttcatcggttttgtcctcaacaacatc
ggacacgtccgtcctcaccgcaccatcctggcgtttgtttcaggaatcttctttatcctt
tctgggctggctctagtggtgggtctggtattgtacatctccagcataaatgatgagatg
ctgaacagaacaaagagcagtgaggtctacttctcctacaagtatggctggtcttttgcc
ttcgctgccctctccttcctgctcactgagagtgcgggagtcatgtctgtctacctgttc
atgaagcgctacacagcagaggagatctaccaggctcgccgccccaatttctaccggcct
cggcttagcaactgctctgaccactccggtcagttcctccacccagagtcctggtcgcgt
ggacgaagcccctctgacatttcaagtgaagcgtcactgcagatgagcgccagctacccc
gctctcctcaaatgtcccgactatgaccaggtgtcatcttcaccttgctga

DBGET integrated database retrieval system