KEGG   Xiphophorus maculatus (southern platyfish): 102227485
Entry
102227485         CDS       T02923                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
KEGG Orthology (KO) [BR:xma00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xma01002]
    102227485
Enzymes [BR:xma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     102227485
Peptidases and inhibitors [BR:xma01002]
 Metallo peptidases
  Family M1
   102227485
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 102227485
NCBI-ProteinID: XP_023199956
Ensembl: ENSXMAG00000000394
Position
12
AA seq 938 aa
MFPLLLVLFVSIHPSSGAQIPNQDQAKELPVATNGEPFPWDRMRLPVTISPLHYDLTIHP
NLTSLDFTGVVRISLDVKEDTSIVILHAKQMHISNVVLLAPEGVRPLRVLEYPRSHQLAL
LSESVLTKGRKYEVQLEFAANLSDSFHGFYKGSYRTSSGEVRAIASTQFEATFARGAFPC
FDEPAFKANFTIRIIREPRHIAISNMPKVKTVELPGGLLEDHFDTTVKMSTYLVAYIVSD
FLSVSKTTKHGVKISVYAVPEKIDQTAFALDAAVKLLDFYDDYFDIPYPLPKQDLAAIPD
FQSGAMENWGLTTYRETGLLFDPDRSSASDKLGITKVIAHELAHQWFGNLVTMEWWNDLW
LNEGFAKFMEFISLDITYPELHVDDFFLGKCFEAMEVDSLSSSHPVSTPVENPTQIQEMF
DDVSYDKGACILNMLRDFLSPEVFEIGIIRYLKRYSYQNTVNSHLWESLTDICSSDALDE
GRLKHTEFCSKRKLQPGSSKWYSDDELDVKTIMDTWTLQEGFPLVTVEVKGREVRLSQER
FLRTDDPSLTEGFLWQIPLTYMTSASNTVHRFLLKTKTDVLYLPEEVDWVKFNVNMSGYY
MVHYAGEGWNSIIKLLQYNHTALSGNDRASLIQNVFQLVSVGKVRLDTALDLSLYLSKET
QIMAVTQGFGELVPLYKLMEKRDMTVLENQMKGYIVDLFRDLIDRQEWSDSGSVSERVLR
SYLLLFACVRNHPPCVAKATKLFNQWKDSDGTMSLPVDITMAVFVIGARAPEGWDFLFEK
YRTSLQMSVKSRIKSAMTVTYLKDKLKWMMEQSLIGEVMKTQDLPDVVVSVGKNPHGYKL
AWDFLRANWHTMIKKFDLGSHSVSYMVLGVTNQYSTREMLQEIRSFFDSLTEETGSKMRC
IQQTYETIEDNIRWTDANFPLLEAWLNKHQHRPPHEDL
NT seq 2817 nt   +upstreamnt  +downstreamnt
atgtttcccctcctgctggtgctctttgtttctattcatccctcatctggagctcaaatc
ccaaatcaagatcaagccaaagagcttcctgtagccaccaacggtgaacccttcccttgg
gaccgcatgaggcttcccgtaaccatcagccccttgcactatgacttgaccatacaccca
aacctcacctccctggatttcaccggggtggttcgcatcagtctggatgtgaaagaagac
accagcatcgttatcctccatgccaagcaaatgcacatatccaacgtggttctcttggca
cctgagggtgtccggcctctacgggtgctggagtaccctcgatcccatcagcttgctttg
ctgtctgaatcagttctgaccaagggcagaaagtatgaggtccagctggagtttgctgca
aacttatctgacagcttccatggtttctacaaaggcagctaccgtacgagcagcggggag
gttcgggccatagcatctacacagtttgaggcgaccttcgctcgtggagccttcccctgt
tttgatgagcctgccttcaaagccaacttcaccatacggatcatccgtgagccacgccac
attgccatttccaacatgcccaaggttaaaacagtggagttgccaggcggtttgcttgag
gatcacttcgacacaaccgtaaagatgagcacttacctggtggcttacatcgtctctgac
ttcctgtctgtgagcaaaacaactaagcatggagttaagatctctgtctatgctgtacca
gagaagatcgatcagacggcctttgcattggatgctgcagtgaagttgttagacttctat
gatgattactttgatatcccatatccacttcccaaacaggacctggctgctatcccggac
ttccagtctggcgcaatggagaactggggtctgaccacctacagagagactggccttctc
tttgatcctgacaggtcctctgcctctgacaaactgggcatcaccaaggtcattgcccat
gagctcgctcatcagtggtttggaaacctggtgacaatggagtggtggaatgacttgtgg
ctaaatgaaggttttgctaagttcatggagttcatttccctcgacattacctacccagag
cttcatgtggatgacttcttcttgggcaagtgttttgaggcaatggaggtagactctctg
agctcgtctcatccagtttccacaccagtggaaaaccccacacagatccaggagatgttt
gatgatgtgtcttatgacaagggggcatgtatcctgaacatgctgcgggacttcctgagc
cctgaagtttttgagatcggtatcatccgatacctgaagcgctacagctaccagaacact
gtgaacagccacctgtgggagagcctgactgatatctgcagctcagatgctctggatgaa
ggtcgactgaaacacacagaattttgctctaaacgcaaactccagcctggatcctctaag
tggtactctgatgatgagcttgatgtcaagactatcatggacacctggacactgcaggag
ggcttcccactggtcacagtagaggtcaaaggtcgggaggtcagactcagtcaggagcgc
ttcctgaggacagatgatccctcgctcactgaaggattcctgtggcagattccactaacg
tacatgaccagtgcttccaacacagttcatcgtttccttctcaagacaaagactgatgtg
ctctacctgccggaggaagtggactgggtgaagtttaatgtcaacatgagtggctattac
atggtccactatgctggtgaaggttggaactccatcatcaaactgctgcagtacaaccac
acggctctctctgggaacgaccgggccagcctcatccagaacgtcttccagctggtcagt
gtcgggaaggtgaggctggatacggccctggatctgtctctgtatctttccaaagagact
cagatcatggctgtgacccagggcttcggagagcttgtgcctctttacaaactgatggag
aagagagacatgacagttctggaaaatcagatgaaaggttacattgtggatcttttccgg
gatctgattgatcgtcaagaatggagtgactccggttcggtgtctgagcgagtgctgagg
agttacctgctgctgtttgcttgcgtcaggaatcatcctccatgtgtagccaaagccacc
aagctctttaaccagtggaaggattcagatggcaccatgagcctccctgttgatatcact
atggctgtgtttgtgattggagcacgagcaccagaggggtgggacttcctctttgagaaa
taccgcacttctctgcagatgtctgtcaagagccgcataaagtctgcgatgactgtcacc
tatctgaaggacaagctcaagtggatgatggagcagagtttgataggagaggtgatgaag
acccaggacctcccagatgtggtcgtctctgttggaaagaatcctcatggttacaaactg
gcctgggactttctccgcgctaactggcacacaatgatcaagaagtttgaccttggctct
cactctgtatcatacatggtgcttggtgtgaccaaccaatactctaccagggagatgctc
caggagatacggagcttctttgactcgctgacagaggaaactgggtcaaaaatgaggtgc
atccagcagacctacgagaccattgaggataacatccgctggacagacgccaactttcct
ctgctagaggcctggctgaacaagcaccaacacagaccacctcatgaagacttatag

DBGET integrated database retrieval system