KEGG   Xiphophorus maculatus (southern platyfish): 102227873
Entry
102227873         CDS       T02923                                 

Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) B-like isoform X1
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
KEGG Orthology (KO) [BR:xma00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102227873
Enzymes [BR:xma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     102227873
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 102227873
NCBI-ProteinID: XP_005807192
Ensembl: ENSXMAG00000005578
UniProt: M3ZTQ0
Position
5
AA seq 317 aa
MVDRAENSQMQRTFVPPIYNVTICGGTHGNELTGVYIVREMQKQKMEKAGSVSVTTVETN
PRAVAAGRRYTEMDLNRCFTDVLLSSPITESTPYEVKRAQELNAQLGPKGSAKAVDLLID
LHNTTSNMGLCFIFYSIDWITLHIYKYIENNLNSVPVRAIQLDIPSSEAYSLESVGKHGF
AIEVGPQPSGVLRADIFNVVKEALDLTLQWLQKFSSGHSFEGGTVDAYTFVKSVDYPRDS
AGKATAIIHQDLQDNDFKLLRSGDPIFQTFSGDILKYEGEDLYPFFVNECAYYEKKIAFH
LAQKKTYSFPHISVKND
NT seq 954 nt   +upstreamnt  +downstreamnt
atggttgacagggctgaaaactctcagatgcagcgcacctttgtcccaccaatatataat
gtcaccatttgcggtggaacccacgggaatgagttgactggggtgtacattgtgagggaa
atgcagaaacagaagatggagaaagctgggtctgtttctgtaaccaccgttgagaccaat
ccaagagccgtggctgctggcagacgatacacagagatggatctgaaccgctgcttcaca
gatgtcttgctgagttcccccataacagagtcaaccccgtatgaggtgaagcgagcccag
gaactgaacgctcagctggggcccaaaggaagcgcaaaggctgttgacctgctcatagat
ctgcacaacaccacttccaacatgggcctgtgcttcatcttctactccatagactggatc
actcttcacatttacaaatacatagagaataacttgaactctgtgcctgtgagagcgatc
cagctggacattcccagctccgaagcttattccctggagtcagtgggcaaacatggcttt
gcgatagaagtcggcccgcagcctagtggtgtgctcagagctgatatcttcaacgtggtg
aaagaagcattggatctcacattacagtggcttcagaaattcagttctgggcacagtttt
gaaggcggcacagtggacgcatacacttttgttaaaagtgttgactacccaagagactcg
gctggtaaagctactgctatcatccaccaagacctacaggataatgactttaagcttctg
cggtcaggggatcccatcttccagacattttctggggatattttgaaatacgagggagaa
gacctctaccctttcttcgtgaatgaatgcgcctactacgagaagaagattgctttccat
ttagctcagaaaaaaacatacagctttccgcatataagcgtgaaaaacgattga

DBGET integrated database retrieval system