KEGG   Xiphophorus maculatus (southern platyfish): 102228021Help
Entry
102228021         CDS       T02923                                 

Gene name
sphk1
Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00600  Sphingolipid metabolism
xma01100  Metabolic pathways
xma04020  Calcium signaling pathway
xma04370  VEGF signaling pathway
xma04371  Apelin signaling pathway
Module
xma_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    102228021 (sphk1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102228021 (sphk1)
   04371 Apelin signaling pathway
    102228021 (sphk1)
   04020 Calcium signaling pathway
    102228021 (sphk1)
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     102228021 (sphk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 102228021
NCBI-ProteinID: XP_023188858
Position
5
AA seq 548 aa AA seqDB search
MDQRRAEPDFLPSATPVTLYGEFTQTSNRRGRWAVNLTEKDLVVQRLASAPVGRNKVVLS
LRDCVGCRAYRDDDKADPSAYFAAYFYPPKKRRWMTSAPSRQRVEQCFRLAALQDPHANL
EEAEKWARAVRERSARQQRLRDGVLLNSLPRPCRILLFVNPQSGKGQALTLYNSHIQRML
NEAGVIHKLIITERQNHARELVKDVDLSQWDALVIMSGDGLLHEVINGLLERPDWEEAIR
TPLGILPGGSANALAASVHYYSGVSQVRGEELLVSCGFLLCRGLVSHMDLVSLHLSSGQR
LFSFLSLAWGFVADVDVESEKYRHVGAARFTVGTLVRLASLRIYKGKLAYLPASRGRHTD
KSLQNGAAACCRNPASCLTQTLEDDFPNNTCHSNNSLKLRRSEGRSSRSAAKALPGPPDA
LLPPLDQPLPSDWVLVPEEDFVLMLAMYQSHLAEDLLAGPDARLADGVIHLFYVMAGISR
SALLRLFLAMEKGAHLDTNCQHLVHAKVRALRLEPGAGKGIITVDGEVVEYGPIQAEVHG
GLGRVISG
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggatcagaggagagccgaacccgactttctaccctctgccactccagtcacgttgtac
ggagaatttacccagaccagtaaccgaagaggcaggtgggctgtaaacctgaccgagaag
gacctcgtcgtccagaggctcgcgtcggcacctgtcggccggaacaaagtggtgctgagt
ctgagggactgcgtcggctgccgggcttaccgggacgatgacaaggcggacccgtcggcg
tactttgcagcctacttttacccaccgaagaagcgccgctggatgacttctgctccgtcg
cggcagcgcgtggagcagtgctttcggctagcggcgctccaggacccgcacgcgaacctg
gaggaggcagagaagtgggctcgcgccgttcgagaacgctctgcccggcaacagcgcctt
agagacggtgtgttgctgaattcgttgccccgtccttgccggatcctgctgtttgtgaac
ccgcagagcgggaaaggacaagccctcaccttgtataacagccacatccagcggatgctc
aatgaggcgggagtcatacataaactcattatcactgagaggcagaatcacgcccgggag
ctggtgaaagatgttgacctgtcacagtgggacgctttagtcatcatgtcaggagacgga
ctgctgcatgaggtgataaatggtctgctggaaaggccagactgggaggaggccatccgc
actccgctgggtatccttcctggagggtcagccaatgccttggctgcatctgtgcattac
tactctggcgtctctcaggtcagaggcgaggagctgctggtcagctgtggtttcctgctc
tgcagaggactggtgtctcacatggacctggtctccctccatctttcctccggccagcgc
ctcttctccttcctctccctggcctggggcttcgtggccgacgtcgacgtggagagcgag
aagtatcgccacgtcggagccgcccggttcaccgtcggcacgctggtgaggctggcgtct
ctccgcatctacaagggtaagctggcttacctccccgccagcagggggcgccacacggac
aaaagtctgcagaacggagcggcggcatgctgcagaaatcccgcctcctgtttgactcaa
actttggaagatgacttcccaaataacacctgccactccaacaactccctgaagctgcgg
aggtcagagggcagatcgtctagaagtgccgccaaagccctccccgggcctcccgacgcc
ctgctgcctcctctggatcagccgctgccgtccgactgggtgctggtgccggaggaagac
tttgtcctcatgctggccatgtatcagtcccacctggccgaggacctcctggcggggcca
gacgcccgcctggccgacggcgtcatccatctcttctacgtcatggcggggatttctcgg
agcgcgttgctccgactgtttctggccatggagaaaggcgcacatctggacacgaactgc
cagcacctggtgcacgcgaaggtgcgggcgctcaggctggagccgggcgccgggaaaggg
atcataacggtggacggagaggtggtggagtacggtccgattcaggccgaggtgcacgga
ggcctggggagggtgatcagcggatga

DBGET integrated database retrieval system