KEGG   Xiphophorus maculatus (southern platyfish): 102228206Help
Entry
102228206         CDS       T02923                                 

Gene name
maob
Definition
(RefSeq) LOW QUALITY PROTEIN: amine oxidase [flavin-containing] B
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00260  Glycine, serine and threonine metabolism
xma00330  Arginine and proline metabolism
xma00340  Histidine metabolism
xma00350  Tyrosine metabolism
xma00360  Phenylalanine metabolism
xma00380  Tryptophan metabolism
xma00982  Drug metabolism - cytochrome P450
xma01100  Metabolic pathways
Module
xma_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102228206 (maob)
   00330 Arginine and proline metabolism
    102228206 (maob)
   00340 Histidine metabolism
    102228206 (maob)
   00350 Tyrosine metabolism
    102228206 (maob)
   00360 Phenylalanine metabolism
    102228206 (maob)
   00380 Tryptophan metabolism
    102228206 (maob)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102228206 (maob)
Enzymes [BR:xma01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     102228206 (maob)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_3 Pyr_redox_2 Thi4 FAD_binding_2 HI0933_like FAD_binding_3 FAD_oxidored Pyr_redox Lycopene_cycl GIDA FMO-like AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 102228206
NCBI-ProteinID: XP_023192330
Position
7
AA seq 563 aa AA seqDB search
MCGRSQVGVGLFNTDALLGVKPCVQRRSDGSVXGAERQTGTMTGDNYDVVVIGAGISGLS
AAKLLKASGLNPVVLEARDRVGGRTFTVRNKETKWVDLGGAYIGPTQNRILRLAKEYGIK
TYKVNEQEHLVHYVNGKSYPFKGSFPPMWNPIVYMDFNNLFRTMDEMGQEIPREAPWRAP
RALEWDNMTMQELFNKICWTSAVRRFATLFVNVNVTSEPHEVSALWFLWYVKQCGGTMRI
FSTTNGGQERKFAGGSSQISECMAKELGDRVKLQSPVYRIDQTGDMVVVETVNKETYTAR
YVVVATPPALNLKMHFNPELPPLRNQLIYRVPMGCVIKCMVYYKENFWRKKGYCGTMVIE
EEGAPIGLTLDDTKPDGTVPAIMGFILARKCRKLADLTKEERLRRICEIYSRVLGSEEAL
HPVHYEEKNWCEEEYSGGCYTAYFPPGTLTQFGRVLREPVGRLYFAGTETASEWSGYMEG
AVQAGERAAREVLCAMGKIHQSQIHQPEPESQEVPALPFVTSFWERNLPSVGGFLKLTGV
SAVLSAAAAVGLVAYKKGLFPRS
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggcggagccaggtgggtgtgggcctgtttaatacagatgcgctcctcggtgtg
aagccctgcgttcagcggcgatcggacggttcggttncgggagcagagcggcagacggga
accatgaccggcgacaactacgacgttgtggtgatcggagcggggatatcaggtttgagc
gctgcaaagctgctaaaagctagcgggctgaatcctgtagtgctggaggccagggatcga
gtcggcggccgcaccttcactgtccggaacaaggagacaaagtgggtagacctcggtggg
gcctacatcggaccgactcagaaccgcatcctacggttggctaaagagtacggcattaag
acctacaaagtcaacgagcaggaacacctggtgcattatgtcaacggaaagtcgtacccg
ttcaaaggctccttccctcccatgtggaaccccatcgtctacatggacttcaacaacctc
ttcaggacgatggacgagatgggccaggagattcccagagaggcgccctggagagctccc
cgtgccttagagtgggacaacatgaccatgcaggagctgttcaacaaaatctgctggacc
agtgccgttcgccgcttcgccaccctgtttgtcaacgtgaacgtgacctctgaaccccac
gaggtgtcggcactgtggttcctctggtacgtgaagcagtgcgggggaacgatgaggatc
ttctccaccaccaacgggggacaggagaggaagtttgcgggcggctccagccagatcagc
gagtgcatggccaaggagctgggtgacagggtgaagctgcagtcgcccgtctacaggatc
gaccagaccggagacatggtcgtcgtggagacggtgaacaaagagacttacacggccaga
tacgtcgtcgtggcaacgccgcccgccctcaacctgaagatgcactttaaccccgagctg
ccgcccctcaggaaccagctgatctaccgcgtgcccatgggctgcgtcatcaaatgcatg
gtctactacaaggagaacttctggaggaagaagggttactgcggcaccatggtgatcgag
gaggagggggctcctataggcctgactctggatgacacaaagcctgatgggaccgtgccc
gctatcatggggttcattctggctcgcaagtgcaggaagctggcagacctgaccaaagag
gagaggctcaggaggatctgtgagatttactccagagtgctgggctcagaggaggctctc
cacccggtgcactatgaagagaagaactggtgtgaggaggaatactccggcggctgctac
acagcttactttcctcctggaaccctgacccagtttggcagggttctgagggagcctgtt
ggcaggttgtacttcgccggcacggagacggcgtcagagtggagtggctacatggagggg
gcggtgcaggccggggagagggccgccagagaggtcttgtgtgcgatgggtaaaatccac
cagagtcaaatccaccagccagagcctgagagtcaggaagttcctgccctgccgtttgtc
accagcttctgggagaggaatctgccgtcggtcggcggttttctcaagctcacgggcgtc
tccgccgtcctgtccgccgccgccgcagtgggcctggtggcctacaaaaagggcctgttc
cccaggagttaa

DBGET integrated database retrieval system