KEGG   Xiphophorus maculatus (southern platyfish): 102229467Help
Entry
102229467         CDS       T02923                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102229467
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xma04030]
    102229467
G protein-coupled receptors [BR:xma04030]
 Rhodopsin family
  Lipid
   Leukotriene
    102229467
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 102229467
NCBI-ProteinID: XP_005796265
Ensembl: ENSXMAG00000019604
UniProt: M4AYV6
Position
4
AA seq 352 aa AA seqDB search
MNISHERSPLEEMALEEFDGGTVVACVILGLSFLVGAPGNLLVIWTILKHVKKRSHTVVL
ILHLAAADLVVLITLPLWIYSLAQSWVFGVTCCKAMVFVINACMYSSVFLITLMSVERFV
AVRYPFVSVVWKKKQALNKVLLALWSAGFLFSIPIIPTQTIGVDDGKTHCLYREYTSDTQ
ELVCLLLETVVGYMLPFSILVVCYGCLCSRITQMNFRSKRKSTVLIASVVVAFAICWTPH
HIGNIISIVILAIDDSESNIALNLEAARQTMAFVAGAMVFISSSINPVLYMFAARSFRES
LRDTGIQKLFRHISSTSPGEGNREISFVSRRQSNQTNCSQLMTESKDDTNMY
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaacatctcacatgaacggtctccgttggaggaaatggcccttgaggaatttgatggt
ggaacagtggtggcgtgtgtgatcctgggtctgtccttcttggttggtgctcctggcaac
ctgcttgtgatctggaccatcctgaagcatgtgaagaagcgctcacacacagtggttctc
atcttgcaccttgcggcggcagatctggtggtcctcattacactccctctatggatctac
tccctcgcacagtcctgggtcttcggagtgacatgctgcaaagccatggtgttcgtgatc
aacgcctgtatgtacagcagcgttttcctcatcacgctcatgagtgtggagcgtttcgtc
gccgtgcgttatcccttcgtctctgtagtttggaagaagaaacaagccttgaataaagtc
ctccttgccctgtggtcagcagggttcctgttcagcatacctattattccgactcaaact
atcggggtggacgatggtaagacgcattgcctgtatcgcgagtatacttctgacactcaa
gagctggtgtgtttgttgctagagacggtggtgggatacatgctgcccttctccattctt
gtggtctgttatgggtgtttgtgcagtcgtataactcagatgaacttcaggtccaaacgc
aagtccactgtcttgattgcaagcgtagtggttgcgtttgctatttgctggacaccacat
catataggaaacatcatctccatcgttattctggccattgatgactcagagagtaatata
gcacttaacctggaagctgctagacaaaccatggcatttgtagcgggagcaatggtcttt
atcagcagcagcattaatcctgtcctgtacatgtttgcggcccgctccttcagggagtcg
ctacgtgacaccggcatccagaaactcttccgccacatctccagcacctcgccgggtgag
ggaaacagggagatatcctttgtgtcgaggagacaaagcaatcagacgaactgctctcag
cttatgacagagtcaaaagacgatactaatatgtattga

DBGET integrated database retrieval system