KEGG   Xiphophorus maculatus (southern platyfish): 102229619Help
Entry
102229619         CDS       T02923                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4-like isoform X1
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102229619
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xma01001]
    102229619
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102229619
Protein kinases [BR:xma01001]
 Serine/threonine kinases: STE group
  STE20 family
   102229619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 102229619
NCBI-ProteinID: XP_014327584
Ensembl: ENSXMAG00000012364
Position
24
AA seq 1474 aa AA seqDB search
MANDSPAKSLVDIDLASLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNQLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIESCLVKNYTQRPPTEQLLKHPFIRDQPNERQVRI
QLKDHIDRTKKKRGEKDETEYEYSGSEDEEEDPPEQEGEPSSIVNVPGESTLRRDFIRLQ
QENKERSEALRHQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREMR
RQQEREQRRREQEEKRRMEEMDRLRKEEEERRRAEEEKRRNDREQEYIRRQLEEEQRHLE
KLQEQLLREQAMLLEFKWRELEEQRKAERLHKRLQQEQAYLLSLQHESKPEPGDKTNPPL
DLSKPPQTSTLPPDGAHTPSPKAEGLDAAASESTKAPLVVPGDGAKSQLGEQDGSDESTP
PVTETPTDSKAPQAESLEAAAHPPQPIREADERFRKNIQGSPQSAPPSKQPPLPPRSSEP
YSNGGSASEATAMHRPMEPQVQWSHLAALKSSNSAAPSPPPPVVSRSQSFSESGGVSSSF
AQLHLRSQDPHHHHHPLPVRPDPQPQPPLHHPQAQTRLERQTSGEEVPPKVPVRTTSRSP
VLSRRESPLPSQPNQRSVGSNVEQRPLWDRVEKLQSRPGSGSSSGSNASSQASPGDRFRP
RCESPASSKSEGSPLQRPENIPKKQEEKNSSRPTRPAGDMDLTALAKELRAVDDVRPPHK
VTDYSSSSDDSGTTDEEDEEEVDQEAGDESTSGAEDSRTGRLSNGETDSAKTMLVDDLES
EQATTPSKDGTLVIRQSTADTKRLVSLSSSSSSSPGSGPSQGVPEKNGFPGRIHHLPDLI
QQSHHSPSSSPAILSSISMSMSPSSSSSSFQSSSSQASPGMCSQIPLDELTAIESQSENN
SMSKHKSSSSFTPFIDPRLLQISPSSGSSLNNMAGFGQEGRLADPLRSDPSRKGSVVNVN
PVNTRPPSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRR
RIQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNKILHNDPEVEKKQGWVNVGDLEGCVH
YKVVKYERIKFLVLALKNSVEVYAWAPKPYHKFMAFKSFGDLVHKPLLVDLTVEEGQRLK
VIYGSCSGFHAVDVDSGAVYDIYLPTHIQTNIQCHAIIILPNTDGIELLVCYEDEGVYVN
TYGRITKDVVLQWGEMPTSVAYIRSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKF
LCERNDKVFFASVRQGGASQVYFMTLGRSSLMSW
NT seq 4425 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgactctccagctaaaagtctggtagacatagacttggcttcattgcgggat
ccggctgggatatttgagctggtggaggtagttggaaatggcacctatggacaagtatac
aagggacgacatgtcaagactggacagctggctgccatcaaagtcatggacgtcacagag
gatgaagaggaggaaattaaactggagatcaatatgcttaagaagtactcccaccacaga
aacatagccacctactacggtgctttcattaagaagagtcccccgggacatgacgaccag
ctctggctggtgatggagttttgtggtgctggttcgatcacagacctggtgaagaacaca
aagggaaaccagctgaaggaagactggattgcctatatttccagagagattcttagaggt
ttggcccacctacacgcccaccatgtgatccaccgtgacatcaaaggccagaacgtcctg
ctgactgagaacgctgaagtaaagctggtggatttcggtgtgagtgcccagctggatcgg
acagtcgggaggagaaacacattcatcgggactccatattggatggccccagaggtcatc
gcttgtgatgagaacccagatgccacatatgattaccgaagcgatctgtggtcctgtggc
atcactgcgatcgagatggcagagggcgcgccgccgctttgcgacatgcaccccatgcga
gcgctcttcctcatcccaagaaaccctcctccgaggctcaaatccaaaaaatggtccaag
aagtttttcagcttcatagagagctgtctggtgaagaactacacgcagcggcctccgact
gagcagctgctgaagcatcccttcatccgggaccagcccaatgagcggcaggtcaggatc
cagctcaaagaccacatcgaccgcaccaagaagaagagaggagagaaggatgaaactgaa
tatgagtacagcggcagtgaggatgaggaagaggatcctccagagcaggaaggagagccg
agctctatcgtcaacgtgccgggagagtcgactctgcggcgcgacttcatccgcctgcag
caggagaacaaggagcggtcagaggcgctccgccaccagcagctcctccaggagcagcag
cttcgtgagcaggaggagtacaagcgccaactactggccgaaagacagaaacgcatcgaa
caacagaaggagcagagacggcggctagaagagcaacagagacgggagcgggagatgagg
aggcagcaggagcgtgagcagcgccggcgggagcaggaggagaagaggcgaatggaggag
atggatcgcctgcgtaaagaggaggaggagcgccggcgagccgaggaggagaagaggagg
aatgaccgcgaacaggagtacatccggcgtcagctggaggaggagcagcggcacctggag
aaactgcaggagcagctgctccgagaacaggccatgttgctggagttcaagtggcgtgag
ctggaggagcagcgcaaggcagagcgcctgcataagcgcttgcagcaggagcaggcctac
ctgctgtcgctgcagcatgaatccaaaccggagcctggcgacaagacaaaccccccacta
gaccttagcaaacccccacagacctccactctgccccccgacggagcccacaccccttcc
cctaaagccgagggccttgacgccgctgcttccgagtccactaaagcccctctggttgtc
cccggagacggcgctaagtcccagctaggagagcaagatgggagtgatgagagcaccccc
cctgttactgaaacccccactgactctaaagctccccaggcagaaagtttggaggctgcc
gctcatccccctcagccaatcagagaggctgacgagcgtttccgaaaaaacattcagggc
tcccctcagtccgcccctccttccaaacagccccctctgcctccccgctcctctgaacct
tactccaacggcggctcggcttcagaggccaccgccatgcaccgacccatggagcctcag
gtccagtggtcccacctggctgctctaaagagcagcaacagtgcggccccctctcctcct
ccgcccgtggtctctcgctcccagtccttcagcgagtctggcggcgtgagctctagcttt
gcacagcttcacctgcgctcccaggacccccaccatcaccaccacccattgcctgtacgc
cccgacccccaaccccaacctcccctccaccacccccaggcccagacccggctcgaacgc
cagaccagcggcgaggaggttcctcccaaggtaccagtgaggacaacatccaggtctcct
gtgctgtctcgcagagagtccccgctgccgtctcagcccaaccagaggagcgttggcagt
aatgtggagcagcgccccctgtgggacagagtggagaagctgcagtctcggcccggcagc
ggcagctcctcgggctccaacgccagctcccaggccagtccgggtgaccgtttcagacca
cgttgtgagtcacctgcttcgtctaaatctgaaggctcgcctctgcagcgtccggaaaac
atcccaaaaaagcaagaagagaagaactcctccaggcctactcggccagccggtgacatg
gacctgactgctctggccaaggagctgcgtgcggtggacgacgtgcggcctcctcacaag
gtgaccgactactcttcatcgagcgacgactccggcaccacggatgaggaggacgaggag
gaggtggaccaggaggcgggagacgagtccacctcaggagctgaggactccaggacgggg
aggctgagcaatggagagactgattcagctaagaccatgctggtggacgacctggagagc
gaacaagccaccactccctccaaagacggcaccctggtcatcagacagagcacagctgac
acaaagcggttggtcagtctctcatcttcctcctcttcctcgcccggctccggccccagt
cagggcgtcccggagaaaaacggctttccgggccgcattcaccacctgccagaccttatc
cagcagagccatcactccccttcctcttctccagccatcctttcctccatctccatgtcc
atgtcgccctcctcctcctcttcctcctttcagtcatcctctagccaggccagtcctgga
atgtgctcacagattcccctggacgagctcactgccatagagtcccagtcagagaacaac
tccatgtccaaacacaagtcctcttcatcgttcacacccttcattgaccctcgtcttctt
cagatatccccatccagcggcagctcccttaacaacatggctggatttggtcaagaaggt
cggctcgctgacccactgaggtccgacccgtcccgcaaaggatcggtggtcaacgtcaac
cctgtcaacacgcgcccaccgagcgacactccagagatccgcaagtacaagaagaggttc
aactctgagatcctgtgtgcagcactctggggagtgaacctgctggtcgggacagagagt
gggctgatgctactggaccgaagcggtcaggggaaagtctacccactgattaatcggcgt
cgcatccagcagatggacgtcttggagggactcaacgttctggtcaccatatcaggtaaa
aagaacaagctgcgagtgtactacctgtcgtggctcaggaacaagattttgcacaacgac
cctgaagtggaaaagaaacagggctgggtgaatgtgggcgacctcgagggctgcgtccac
tacaaagtcgtgaaatacgagaggattaagttcttggtgttggccttgaagaactctgtg
gaagtgtacgcctgggctcccaaaccctaccataaattcatggcattcaaatcttttggc
gacctcgtgcacaagcctctgctggtcgacttgactgtggaggagggtcagaggttaaag
gtcatctacggctcctgctcaggcttccacgccgtcgacgtggattccggcgccgtctac
gacatttacctgcccacacacatccagaccaacattcagtgccacgccatcatcatcctc
cccaacacagacggcatcgagctgctggtgtgctacgaggacgagggcgtctacgtgaac
acctacggacgcataaccaaggacgtggtgctgcaatggggagaaatgccgacttcagtg
gcctacattaggtcaaaccagataatgggctggggagagaaagctatcgagatccgctcg
gtggagacgggacacctggacggcgtctttatgcacaaaagagcccagagacttaaattt
ctttgcgagaggaatgacaaggtctttttcgcctccgtgcgtcaaggcggcgccagccag
gtgtattttatgaccctgggacgctcctcccttatgagctggtag

DBGET integrated database retrieval system