KEGG   Xiphophorus maculatus (southern platyfish): 102229900Help
Entry
102229900         CDS       T02923                                 

Gene name
thnsl2
Definition
(RefSeq) threonine synthase-like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
KEGG Orthology (KO) [BR:xma00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102229900 (thnsl2)
Enzymes [BR:xma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     102229900 (thnsl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP Trypan_PARP YjeF_N COS
Motif
Other DBs
NCBI-GeneID: 102229900
NCBI-ProteinID: XP_005813876
Ensembl: ENSXMAG00000010684
Position
8
AA seq 517 aa AA seqDB search
MRYCSTRGGVRDRDFRDVLFSGFAPDGGMFMPETLPAVSPETLRSWKGQRYQRLVLEVAS
LFIPEELIPRDDLEGLVAEALSGFSVPDSVRIVRLKDGLSVLELFHGETLAFKDLAMSCT
VHFLNYFLRRDGSRAVVLVGTSGDTGGSAVRSARSLPGLDVLVVFPRGRITAVQEKHMTT
CLEDNVHVFAADGSSDDIDRPLRRLFADQNLVRTHGLMSLNSVNWSRVMIQVAHFFYAYL
ELSGLGAEPGPGAEPGPGAEPGPGAEPNLGAEPGPEPGALPELEVVVPTGGAGNIAAAYI
ALRMGLPLKLVAMVNANDIVHRTVTSGDFSMATSVTQTLAPAIDIQDPYNMERVFWLLLD
RDGAVVKTMMEEFQRSHRLRLPENQRRLLAEVLVTGAVSDPGILETMRRCWEQNQYLLCP
HTAVAVWHHYNRTHRASRNRCYVATASPAKFQAAVEKAGLTFDPPEAVLALDQLPTRYQN
LERSADWCEDWEERLRDWIQFVSRTRKKGGVCYPESP
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcggtactgcagcacccggggcggggtccgggaccgggacttcagggacgttctgttc
tccggattcgctccagatggagggatgttcatgccggagacgctgcctgcagtgagtcca
gagacgctgcgcagctggaaggggcagcggtaccaaaggctggttctggaggtcgcttcc
ctgttcatcccagaggagctgatccccagagacgacctggagggtcttgtagctgaagct
ctctctgggttctcggttcccgactcggtccggatcgtccggctgaaggacggtttgtcg
gttctggaacttttccatggagaaactttggcgttcaaagatctggccatgagctgcacc
gtccacttcctcaactacttcctgcggagagacggcagccgagccgtcgtcctggttgga
acatcaggagacaccggcggttcggccgtccgcagcgcccggtctctgccgggtctggat
gttctggtggttttccctcggggtcggatcacggcggtccaggagaaacacatgacaacc
tgcctggaggacaacgtccacgtgttcgcagccgacggcagctcagacgacatcgaccgg
cccctccgccgcctgttcgccgatcagaacctggtccggacccacggcctgatgagcctc
aactctgtcaactggtccagagtcatgatccaggtggcgcacttcttctacgcctacctg
gagctgagcggcctgggggcggagcctggaccgggggcggagcctggaccgggggcggag
cctggaccgggggcggagcctaacctgggggcggagcctggacccgagcctggagcgctg
ccggagctggaggtggtggttccgaccggaggagccgggaacatcgcagctgcctacatc
gcgctgcggatgggcctgccgctgaagctggttgccatggtgaacgctaatgacatcgtg
catcggacggtaaccagcggcgatttctccatggcgaccagcgtcacccagactctggct
ccggccatcgacattcaggacccgtacaacatggagcgggttttctggctgctgctggac
cgggacggcgccgtggtgaaaaccatgatggaggagttccagcgttcccatcgactcagg
ctgccagagaaccagcgcagactgctggccgaggttctggtgaccggcgccgtgagcgac
ccgggaatcctggagaccatgaggcggtgctgggagcagaaccagtacctgctgtgtcct
cacacggccgtggccgtctggcaccactacaacagaacccaccgggccagcagaaacaga
tgctacgtcgctacggcgtctccagcgaagttccaggcggcggtggagaaggctggcctg
acctttgacccccctgaggccgtgctagctttggaccagttacccacccggtaccagaac
ctggagaggagcgcggactggtgcgaggactgggaggagcgtctgagggactggatccag
tttgtgagcagaaccaggaagaagggaggagtttgttaccctgagagtccatag

DBGET integrated database retrieval system