KEGG   Xiphophorus maculatus (southern platyfish): 102230257Help
Entry
102230257         CDS       T02923                                 

Gene name
pik3cb
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00562  Inositol phosphate metabolism
xma04012  ErbB signaling pathway
xma04068  FoxO signaling pathway
xma04070  Phosphatidylinositol signaling system
xma04140  Autophagy - animal
xma04150  mTOR signaling pathway
xma04210  Apoptosis
xma04218  Cellular senescence
xma04370  VEGF signaling pathway
xma04510  Focal adhesion
xma04620  Toll-like receptor signaling pathway
xma04625  C-type lectin receptor signaling pathway
xma04810  Regulation of actin cytoskeleton
xma04910  Insulin signaling pathway
xma04914  Progesterone-mediated oocyte maturation
xma04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102230257 (pik3cb)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    102230257 (pik3cb)
   04370 VEGF signaling pathway
    102230257 (pik3cb)
   04068 FoxO signaling pathway
    102230257 (pik3cb)
   04070 Phosphatidylinositol signaling system
    102230257 (pik3cb)
   04150 mTOR signaling pathway
    102230257 (pik3cb)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    102230257 (pik3cb)
  Cell growth and death
   04210 Apoptosis
    102230257 (pik3cb)
   04218 Cellular senescence
    102230257 (pik3cb)
  Cellular community - eukaryotes
   04510 Focal adhesion
    102230257 (pik3cb)
  Cell motility
   04810 Regulation of actin cytoskeleton
    102230257 (pik3cb)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    102230257 (pik3cb)
   04625 C-type lectin receptor signaling pathway
    102230257 (pik3cb)
  Endocrine system
   04910 Insulin signaling pathway
    102230257 (pik3cb)
   04914 Progesterone-mediated oocyte maturation
    102230257 (pik3cb)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    102230257 (pik3cb)
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102230257 (pik3cb)
Membrane trafficking [BR:xma04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102230257 (pik3cb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_C2 PI3K_rbd DUF4135 2_5_RNA_ligase2 RWD
Motif
Other DBs
NCBI-GeneID: 102230257
NCBI-ProteinID: XP_023207087
Ensembl: ENSXMAG00000006594
Position
18
AA seq 1079 aa AA seqDB search
MPPAMTDLLDIWAAHSPLAGHAPDQITVDFLLPTGIYIQMDVPREATIQHIKLLLWKQAQ
NFPLFPSLGEMESHMFECVNQAAVHEELEDETRRLCDVRPFLPVLKLVTRNCGRAERLLD
SKIGVLIGKGLHELDGINDQEVKDFRSKMFRLSEEKMQRVQMMTCDEWLQACFSPQLEPA
ALTTITDGLNDRPADLKVIIHFDQSQDSTSLKVLSSSTPSELMEMAVKKWLITHAPEEEE
WSGQYVLRVSHCLEFLCGDHPLIQYKYIRTCLQAKEPPHLTLVHTSTIKELFDKEMSAIS
AVVSRKSSNPPLPLPPKRRIPTQAQTCVWDVTSSFRIVLVKGSKVNAEESAKVQVRAGLF
HGTELLCKPAVSSETSGRSEHTWRDNALEFDISISDLPRMTRLCFAIYAVMDKVKKQKST
KNPHINKYQTIRKAGKVHYPIAWVNTMVFDYKGQLKTGDIILHCWSSFPDELEEMLNPIG
TIQTNPYTENATALHIHFPEYSPYPIVFPPFDKILEKAAQIARASDSMSIGRGGKKFHIE
LKEIMERDPLSQLCENEKDLIWTLRHDCRENFPQSLPKLLLSVKWSKHEDMAQLQALLQI
WPKLCPRDALELLDFNYPDQYVREYAVGCLRDMSDEELSQYLLQLVQVLRYEPYYDCALT
HFLLERAERNRKIGHFLFWHLRSEIHMPAVSVQFSLILEAYCRGSIPHIEVLKKQVEALT
KLKSVNELIKLGTLKNARSKTKEAMLTKEAMITCLKQSGYSEALSDLSSPLNPSVLLSDI
SVEKCRYMDSKMKPLWIVYNNKLLNGDTLGIIFKNGDDLRQDMLTLQILRLMDLLWKEAN
LDLRIVPYGCLATGDRAGLIEVVSSADTIANIQLTNCNVAATAAFNKDALLNWLKERNSG
DALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVRSTGQLFHIDFGHILGNFKSKFGI
KRERVPFILTHDFIHVIQQGKTGNTEKFGSFRQYCEDAYLILRKNGNLFITLFALMLTAG
LPELTSVKDIQYLKDSLALGKTDDEALKQFRQKFDEALRESWTTKVNWMAHNVAKDNRS
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctgccatgacagacctcctggacatatgggcggcccactcgcccctggccgga
cacgctccggatcagatcaccgtggacttcctgctgcccaccggcatctacatccagatg
gatgttccccgcgaggccacaattcaacacatcaaactgctcttatggaagcaggctcag
aacttcccactgtttccctcccttggcgaaatggagagccacatgttcgaatgtgtcaac
caggcagctgtgcacgaagaactggaggatgaaacccgccgactgtgcgacgttcggccc
tttctgccagtcctgaagctggtgacgcgcaactgtggacgagctgagcgcctgctggac
tccaaaataggagtactcattggaaaaggtctccatgaactggatggcattaatgaccag
gaggtgaaggacttccgcagtaagatgtttcgtctcagtgaagagaagatgcaacgagtg
caaatgatgacgtgcgacgagtggctgcaggcctgtttctcgccgcagctggagcctgca
gcattgacaactatcacagatgggctcaatgaccggccagccgatcttaaagtcatcatc
cactttgaccagtctcaggactcaacaagtctaaaggtgttgtcgtctagtaccccctct
gagctgatggagatggctgtgaaaaagtggcttatcactcacgcgcctgaggaggaggag
tggagtggtcagtacgtgctccgagtcagccattgcctggagttcctctgtggagaccat
cctctgattcaatacaagtacattcgcacatgccttcaagctaaggagcctcctcacctc
accctggtccacaccagcaccattaaggagctgttcgacaaggaaatgtctgccatcagt
gccgtagtcagccgcaagtcctccaatccaccgttaccactacctcccaaacgaagaatt
cccacgcaagcccagacgtgtgtgtgggatgtgacgagctcgttcaggatagtcctggtg
aaaggcagcaaggtgaatgccgaagagagcgcaaaggtccaggtgagggcgggcctcttt
cacggcacagaactgctgtgcaagccggccgtgagcagtgagaccagtgggcgctcggag
cacacctggagggacaacgctctggagtttgatatctccatctctgatttaccacgcatg
acccggctatgcttcgctatctacgccgtcatggataaggtcaagaagcagaagtccacc
aagaatcctcacataaataaataccagaccatccgaaaggcagggaaagtgcactacccc
atagcttgggtcaacacaatggtgtttgactacaaagggcagctgaagactggagacatt
atcctgcactgctggtcttcttttcctgatgaacttgaagagatgctgaacccaatagga
accattcagaccaacccatacactgagaacgccacagcgctgcacatccactttccagag
tactctccatatcctatcgtctttccccctttcgacaagatcctggaaaaagctgcacag
attgccagagccagtgactccatgtccataggtcgcggtggtaagaagttccacatagaa
ctgaaggagattatggagcgggacccgctttctcagctgtgtgaaaacgagaaggattta
atttggacactacgccacgactgccgtgagaatttcccccagtctctaccaaagctgttg
ctctccgttaagtggagcaaacacgaggacatggcccagctccaggccctgcttcagatt
tggcctaaactttgtcccagagatgctctggagcttctggacttcaactatcctgatcag
tatgtcagagagtacgctgtgggctgcctgcgggacatgagtgatgaggaactgtctcag
tacctcctgcagttggtgcaggtgttgcgttatgagccttattatgactgcgcactcacc
cacttcttgctggaacgtgcagaaaggaaccgtaaaattggacacttcctcttctggcac
cttcggtcagagatccacatgccagccgtgtcagtccagttctccctcatcctggaggcc
tattgtagaggaagcatccctcatattgaggttttaaagaaacaggtagaagccctgact
aagctgaagtctgtcaatgagttaatcaagctgggaacccttaaaaatgctcgaagcaaa
acaaaggaagccatgttgaccaaggaggccatgataacgtgtttgaaacagagcggctac
tcggaggctctgtcagacctgagctcccctctcaaccccagtgtgctgctgtctgacatc
agtgtggagaagtgtcgctatatggactccaagatgaagcctctttggattgtttacaac
aacaagctgcttaatggagatactttgggaatcatcttcaaaaatggagacgacttgagg
caagacatgttgaccctacagatactgaggttgatggatcttctgtggaaggaagcaaat
ctggacctcaggattgttccatatggttgcttagcaacgggtgacagagcaggactcatt
gaagtggtctcatcagcagacacgatcgccaacatccagttgaccaactgcaacgttgca
gcaaccgcagcgttcaacaaggacgctttgctaaactggctgaaagaaaggaactctggt
gatgcgctcgaccgggccatcgaggagttcacattgtcctgtgcgggctactgtgtagct
acttacgtcctgggcattggagaccgccacagcgacaacatcatggtccgcagcacgggg
cagctgtttcacatagacttcggtcacatccttggcaacttcaagtccaagttcggaatc
aagagggaacgcgtaccctttattctcacacatgacttcatccatgtcattcaacagggc
aagacggggaacacggaaaaatttggcagttttcgtcaatattgcgaggacgcttatctt
atcttgaggaagaacggcaacctcttcatcacgctgtttgccctcatgctgactgctgga
ctacctgagttaacctctgtcaaagacatccaatacctaaaggactctcttgctctgggg
aagacagacgatgaggccctgaagcagttccgccaaaagtttgatgaagcgctgagagaa
agttggacgaccaaggtcaactggatggcccacaacgtggccaaagacaaccgctcctag

DBGET integrated database retrieval system