KEGG   Xiphophorus maculatus (southern platyfish): 102230621Help
Entry
102230621         CDS       T02923                                 

Gene name
parp2
Definition
(RefSeq) poly [ADP-ribose] polymerase 2
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma03410  Base excision repair
xma04210  Apoptosis
xma04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:xma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    102230621 (parp2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102230621 (parp2)
   04217 Necroptosis
    102230621 (parp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xma03032]
    102230621 (parp2)
   03036 Chromosome and associated proteins [BR:xma03036]
    102230621 (parp2)
   03400 DNA repair and recombination proteins [BR:xma03400]
    102230621 (parp2)
Enzymes [BR:xma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     102230621 (parp2)
DNA replication proteins [BR:xma03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     102230621 (parp2)
Chromosome and associated proteins [BR:xma03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    102230621 (parp2)
DNA repair and recombination proteins [BR:xma03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     102230621 (parp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR WWE
Motif
Other DBs
NCBI-GeneID: 102230621
NCBI-ProteinID: XP_005796607
Ensembl: ENSXMAG00000005402
Position
6
AA seq 652 aa AA seqDB search
MRRTRGSRNKSQSTVENEEVPTKTVWQWKGDDGQWEPYPDEAGSMLDSASSSGKTSVTLT
LGAGKKYEVDLKKMVQINPTTKYKRKIRSQIVKTESLNEAGDVAAENGDSVQVKEEEEEE
ETAEQPAAKRRRGQRKSAAKTKEMPKEDIKTEEVVRTVVMKGKAPVDSECKAKLGKAHVY
SEGNDVYDVMLNQTNLQFNNNKYYLIQLLEDGGAKAYSVWMRWGRVGKVGQNSLTPCGAD
LLKAKDIFKKKFLDKTKNEWDHRECFEKVAGKYDLVFMDYAANEKEENITTVDVAPRKQP
SKLEAKLQSLLELICDLRAMEECVLEMKFDTRKAPLGKLTSEQIRAGYEALKRIESCLKK
KGSNKELLEACNQFYTRIPHDFGLKTPPVIRSEEELKEKIALLEALSDIQIAVKMAESNA
DSDEHPLDRQYHALQCQLEPLDQSSHEFKVIERYLQSTHAPTHSDYTMKVLDVFSVDRGG
ESDNFLSHLHNRTLLWHGSRLSNWVGILSKGLRVAPPEAPVTGYMFGKGIYFADMSSKSA
NYCFANQSHHVGLLLLSEVALGDSNELLDADYEAHKLPAGKHSTKGLGVTGPDPKNAVTL
NGATVPMGPGVKTGVSNSNGYSLLYNEFIVYNPAQTRMRYLLRIQFNYSSLW
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaggagaaccaggggttccagaaataaaagccagagtaccgtagaaaacgaggaagtc
ccgacaaagacagtgtggcagtggaaaggagatgacgggcagtgggaaccgtacccagat
gaagcgggctccatgctggactcagcttcctcatcaggaaagacatcggtcactctgact
cttggcgcagggaagaaatatgaagttgatctgaagaaaatggtccagattaatcctacg
acaaagtacaagagaaagattcgctctcagatagtaaaaactgagagtttaaatgaagcc
ggtgacgtggcggctgaaaatggagattcagttcaagtcaaagaggaagaggaagaggag
gagacagcggagcagccggcagctaagaggagaagaggacagaggaagagtgcagcaaaa
accaaagaaatgcctaaagaggatataaaaactgaagaggtggtgaggacggtggtgatg
aagggcaaagctccagtggactctgaatgcaaagctaaactgggaaaggctcatgtttac
agtgaaggaaatgatgtttacgatgtgatgctgaaccagaccaacctgcagttcaacaac
aataaatattacctgatccagctgctggaggacggcggcgccaaggcttacagcgtctgg
atgagatggggccgagtgggtaaagtgggtcagaacagcctcacaccctgcggggcagat
ctgctgaaagccaaagacatcttcaagaaaaagttcttggataagacaaagaacgagtgg
gatcacagggaatgttttgagaaagtagccggaaaatatgacctggtgttcatggactac
gccgctaacgagaaggaggagaacatcaccacagtcgacgtcgcgcccagaaaacagccc
tccaagctggaagcgaagctccagtcgctcctcgaactcatctgtgacctcagagccatg
gaggagtgtgtgctggagatgaagttcgacaccagaaaagctcctcttggaaagctgacc
tcggagcagatccgcgccggatacgaagccctgaagagaatcgagtcgtgcttgaagaag
aagggaagcaataaggagctgctggaagcctgcaaccagttttacacccgtatcccgcat
gactttgggttaaaaacgcctccagtgattcgctcagaagaagaactgaaggaaaaaatt
gctctgttggaggcgctgagtgacatccagatagcagtgaaaatggccgagtccaatgca
gacagtgacgagcatcctttggacagacagtatcacgccctgcagtgccaactggagcct
ttggaccagagcagccatgagttcaaggtgatagaacggtacctgcagtccactcacgct
cccactcactccgactacaccatgaaggtcctggacgtcttctcagtggaccggggcggc
gagagcgacaacttcctgtctcatttacacaacaggactctgctgtggcacggctcccgt
ctgtctaactgggtcgggatcctcagtaaggggctccgagtggcgccgcctgaggccccc
gtcaccggctacatgtttggtaaagggatttacttcgcagacatgtcgtcaaaaagtgcc
aactactgtttcgccaaccagagccaccatgttggattgctgctgctgagtgaggtggct
ttaggggacagtaacgagctgctggacgccgactatgaggcccataagttgcctgcagga
aaacacagcaccaagggcctgggtgtgaccggacccgacccaaaaaacgccgtcacgctc
aacggagcgacggttccgatgggtcccggcgttaaaacgggggtttctaactccaacggc
tactctctgctctacaacgagttcatcgtttacaacccggctcagacccggatgaggtac
ctgctgcggatccagtttaactactcctctctctggtga

DBGET integrated database retrieval system