KEGG   Xiphophorus maculatus (southern platyfish): 102230689Help
Entry
102230689         CDS       T02923                                 

Definition
(RefSeq) heat shock 70 kDa protein 1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma03040  Spliceosome
xma04010  MAPK signaling pathway
xma04141  Protein processing in endoplasmic reticulum
xma04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:xma00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102230689
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102230689
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102230689
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102230689
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xma01009]
    102230689
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:xma03041]
    102230689
   03009 Ribosome biogenesis [BR:xma03009]
    102230689
   03110 Chaperones and folding catalysts [BR:xma03110]
    102230689
   04131 Membrane trafficking [BR:xma04131]
    102230689
   03051 Proteasome [BR:xma03051]
    102230689
   03029 Mitochondrial biogenesis [BR:xma03029]
    102230689
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xma04147]
    102230689
Protein phosphatases and associated proteins [BR:xma01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     102230689
Spliceosome [BR:xma03041]
 Complex B
  Other components
   Prp19 complex
    102230689
 Complex C
   Prp19-CDC5 complex
    102230689
Ribosome biogenesis [BR:xma03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    102230689
Chaperones and folding catalysts [BR:xma03110]
 Heat shock proteins
  HSP70 / DNAK
   102230689
Membrane trafficking [BR:xma04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    102230689
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    102230689
Proteasome [BR:xma03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    102230689
Mitochondrial biogenesis [BR:xma03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    102230689
Exosome [BR:xma04147]
 Exosomal proteins
  Proteins found in most exosomes
   102230689
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 102230689
NCBI-ProteinID: XP_005813644
UniProt: A0A3B5R827
Position
16
AA seq 639 aa AA seqDB search
MCAAKNVAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VALNPSNTVFDAKRLIGRKFEEPVVQADMKHWPFEVLSDGGRPKIQVEYKGENKAFFPEE
ISSMVLVKMKEIAEAYLGHKVSNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGKSGERNVLIFDLGGGTFDVSVLTIEDGIFEVKATAGDTHLGGEDFDNRMV
NHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLFEGVDLYTSIT
RARFEELCSDLFRGTLEPVEKALRDAKMDKGQIHDAVLVGGSTRIPKIQKLLQDFFNGRE
LNKSINPDEAVAYGAAVQAAILTGDTSGNVQDLLLLDVAPLSLGIETAGGVMTALIKRNT
TVPTKQTQVFSTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELTGIPPAPRGVPQIEVTF
DVDANGILNVSAVDKSTGKENKITIANDKGRLSKDEIERMVQDAEKYKAEDELQRDKIAA
KNSLESYAFTVKSSVEDESLKGKISQEDKKKVVDKCQETISWLENNQLAEKDEYQHQQKE
LEKVCNPIISNLYQGGRPTGSCREQAGAHSQGPTVEEVD
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgcagctaaaaacgtggccatcggcatcgacctgggcaccacctactcctgcgtg
ggggttttccagcacggaaaagtggaaatcatcgccaacgaccagggcaacaggaccacc
cccagctacgtggccttcactgacaccgagaggctgatcggggacgcggccaagaaccag
gtggccctgaaccccagcaacacggtgtttgacgccaagaggctgatcggcagaaagttt
gaagagccggtggtgcaggccgacatgaagcactggcccttcgaggtgctttcagacgga
ggcaggcccaaaattcaggtggagtacaaaggggagaacaaagccttcttccctgaggag
atctcctccatggtcctggtgaagatgaaggaaatcgccgaggcctacctgggccacaag
gtgtccaacgccgtggtcacggtccccgcctacttcaacgactcccagcgacaggccacc
aaagacgcaggcgtcattgcgggactcaacgtcttgaggatcatcaacgagcccacggcg
gccgccatcgcctacggtctggacaaaggcaagtcgggagagagaaacgtcctgatcttt
gacctgggcggaggcaccttcgacgtgtccgtcctgaccatcgaggacggcatctttgag
gtgaaggccacggccggagacactcacttgggaggagaggactttgacaaccgcatggtc
aaccactttgtggaggagttcaagaggaaacacaagaaggacatcagccagaacaagaga
gccttgaggaggctgcgcacagcttgcgagagggccaagaggaccctgtcctccagctcc
caggccagcatcgagatcgactctctgttcgagggtgtggacctgtacacctccatcacc
agggctcgctttgaggagctgtgctccgacctgttcaggggaaccttggagcctgtggag
aaggctttgagggacgccaagatggacaagggccagatccatgacgcggtcctggtggga
ggctccacccgaatccccaagatccagaagctgctgcaggacttcttcaacggccgggag
ctgaacaagagcatcaacccggacgaggcggtggcttacggcgccgccgtccaggccgcc
atcctgacgggagacacgtcggggaacgtccaggacctgctgctgctggacgtggctcct
ctgtccctggggatcgagacggccggaggagtgatgactgccctgatcaaacgcaacacc
accgtccccaccaagcagacccaggtgttcagcacctactccgacaaccagcccggggtc
ctgatccaggtctacgaaggggagagagccatgaccaaggacaacaacctgctgggcagg
tttgagctgacgggaatcccgcccgctccacgaggggtcccgcagatcgaggtcaccttt
gacgtggacgccaacggcatcctgaacgtgtccgcggtggacaaaagcaccggcaaagag
aacaagatcaccatcgccaacgacaagggccgactgagcaaagacgagatcgagaggatg
gtgcaggacgccgagaagtacaaagccgaggacgagctgcagagggacaagatagctgcc
aagaactccctggagtcctacgctttcaccgtgaagagcagcgtggaggacgagagcttg
aagggcaagatcagccaggaggacaagaagaaggtggtggacaagtgccaggagaccatc
agctggctggagaacaaccagctggctgagaaagacgagtaccaacaccagcagaaagag
ctggagaaggtgtgcaaccccatcatcagcaacttgtaccagggagggaggcccactggg
agctgcagagagcaggcaggagcccacagccaggggcccactgtggaggaggtggactga

DBGET integrated database retrieval system